KEGG   Cupriavidus necator N-1: CNE_1c27390Help
Entry
CNE_1c27390       CDS       T01564                                 

Definition
(GenBank) transcriptional regulator NrdR
  KO
K07738  transcriptional repressor NrdR
Organism
cnc  Cupriavidus necator N-1
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cnc03000]
    CNE_1c27390
Transcription factors [BR:cnc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CNE_1c27390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-cone PP-binding_2 Zn_Tnp_IS1595 TF_Zn_Ribbon Cys_rich_CPXG Elf1 Lar_restr_allev
Motif
Other DBs
NCBI-ProteinID: AEI78053
UniProt: G0ET47
Position
1:2839873..2840340
Genome map
AA seq 155 aa AA seqDB search
MKCPFCGHSNTQVLDTRMSEDGDAVRRRRRCEACDRRFTTYERIELFFPAIVKKNGSRVD
YTRAKLKDSMRLALRKRPVSAEAIDEAITRIEEKLLALGEKEIPSSQVGELVMRELRKLD
KIAYIRFASVYRSFEDVSEFRDVLDEFAASTPRKG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgccccttttgcggtcattccaatacccaggtactcgacacgcgcatgtcggaa
gacggcgatgccgtgcgccggcgccgccgctgcgaagcctgcgaccgccgcttcaccacc
tatgagcggatcgagctgttcttccccgccatcgtcaagaaaaacggctcgcgcgtcgac
tacacccgcgccaagctgaaggattccatgcgcctggcgctgcgcaagcgcccggtctcg
gccgaagccatcgacgaagccatcacccgtatcgaagaaaaactgctggccctgggcgaa
aaggaaatccccagcagccaggtcggcgagctggtgatgcgcgaattgcgcaagctcgac
aagattgcgtatatccgctttgcttcggtgtaccggagctttgaggacgtgtcggaattc
cgcgacgtgctggatgaatttgcggcgtccaccccccggaaggggtag

DBGET integrated database retrieval system