KEGG   Cupriavidus necator N-1: CNE_1c27640Help
Entry
CNE_1c27640       CDS       T01564                                 

Definition
(GenBank) transcriptional regulator XRE family
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_25 HTH_23
Motif
Other DBs
NCBI-ProteinID: AEI78078
UniProt: G0ETM9
Position
1:complement(2865767..2866459)
Genome map
AA seq 230 aa AA seqDB search
MNATENTPPVRLLTPAELAVCIKVFRDARQWTQEQLAVIAGLNVRTVQRVEQGWPAGPDI
CRALASAFDFLDIDALNKPFAIPPEDELKAAQEQFDREHVTFAAIRLTTGKQLAELAQTS
TMDMSELAFEMGGEADKRFAALMEYFRNYRDALDAYTEAEKREASDTMQANIDVLKTLGV
SLCYAERQVLLKGSSDPDRPMPANVLYVIGFPLGKEPKLFATPASIDIRL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgacggaaaacacgccaccagtacgcctgctgactcccgccgagctggctgtc
tgcatcaaggtgttccgcgacgcccggcaatggacgcaagagcagctagccgtgatcgca
ggactcaacgtgcgaaccgtccagcgcgtcgaacaaggctggcccgctggccccgacatc
tgccgggcgctggccagcgcgttcgatttcctggacatcgacgcgcttaacaagccattc
gcgattccaccagaagacgaactcaaggcagcgcaggaacagttcgaccgggagcacgtc
accttcgcggcgattcggctgaccacgggtaagcagttggcggagctggcgcagaccagc
acgatggacatgtcggagctggccttcgaaatgggcggcgaagcggacaaacgcttcgcc
gcactgatggaatatttccgtaactaccgcgatgccctggacgcctataccgaagcagag
aagcgcgaggcgtcggacacaatgcaagccaacatcgatgtgctcaagacccttggcgtt
tcgctctgctatgccgagcgccaagtgctgctgaagggaagctcggacccggacaggcca
atgccagctaacgtcctgtacgtgatcggatttccgctcggcaaggaacccaagctattc
gccacgccagcttccattgatatccgtctgtag

DBGET integrated database retrieval system