KEGG   Cupriavidus necator N-1: CNE_1c27680Help
Entry
CNE_1c27680       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: AEI78082
UniProt: G0ETN3
Position
1:complement(2872138..2873655)
Genome map
AA seq 505 aa AA seqDB search
MTLYTTDYLEYYLTLVGWVVNNGIWNILVESGLFALPFVAIVIHEWLRARTEGADEGNKG
VLSSMRIENRVWVAIVVILFAGIPFIPVDLSTIKFDTSRSRQCQVNVPQPADTGWSSSYT
TLNDQSALVPVWWFFMHAISKAVTGAAVAAIPCGTDLRQMRMDVDATRIDNPVLAQEVGD
FVRDCYGPSRAKLFMSRPTLSDEQMNDVTWIGSGYFLNTAGFYDTYHSSTPRTAWPYDAA
RDAGLAQVDSGGGYPTCRQWWSDGSSGLRARLLGQVDPDLLSRIGRWAGFLSQNEVNDSV
VRAVVSPRHQKMNQGAVYTDYGGQIEKTLPNIVARGTGDLGLAAGSPGFFPAMDVVRQAL
PMVLSLLKMALVICIPLVLLFGTYELKAVVAVSCAEFALFFVDFWFQLARWLDSTILDAL
YGWGFGANRPHSNFDPLIGLNNAFGDMLLNFVMATMFIVLPTFWVAALSLAGVRAGGMLQ
GLSDVTRPAGQAGGKGAGVVSNKLR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctacacgaccgactacctggagtattacctgaccttggtggggtgggtggtc
aacaacggcatctggaacatcctcgtggaaagcggcctgttcgcgctgccgttcgttgcc
atcgtgatccacgagtggctgcgcgcgaggacagaaggcgcggacgagggcaacaagggc
gtgttgtcctcgatgcgcatcgagaaccgcgtgtgggttgcgatcgtagtgatcctgttc
gccggcatccccttcattccggttgatctcagcacgatcaaattcgacacgagccgttcc
cggcagtgccaagtcaatgtcccccagccggccgatacgggttggtccagctcctatacg
acgctcaatgaccagagcgcactggtgccggtgtggtggttcttcatgcacgccatctcg
aaggccgtcacgggcgccgcggtggcggcgattccttgtggaactgacctgcggcagatg
cgcatggatgttgacgccactcgcatcgataacccggtgctggcccaggaagttggcgat
ttcgtgcgtgactgctatggcccttcgcgcgccaagctgttcatgagccggccgacgctc
tccgacgaacagatgaacgacgtcacctggatcggttcgggctacttcctcaacaccgcc
ggcttctacgacacctaccattcgagcacaccgcgcacggcttggccttatgacgcggcc
cgcgatgcggggctggcccaggtggacagtggcggcggctatccgacctgccggcaatgg
tggtccgatggcagcagtgggctgcgcgcacgcctgttgggccaggtcgatcccgatctg
ctctctcgtatcgggcgatgggcggggttcctctcgcagaatgaggtcaacgactcggtg
gtccgcgccgtcgtctcgccccggcatcagaagatgaaccagggggccgtttataccgac
tacggcggtcagatcgagaagacgctgcccaacattgtggcgcgcggcactggcgatctc
ggcctagccgccgggtcgcctggtttcttcccagccatggacgtggtgcgccaggcactg
ccgatggtgctgtcgctgctcaagatggcactcgtcatctgcatcccactggtgctgctg
ttcggcacctacgagctgaaggccgtggtcgctgtgagctgcgccgagttcgcgctgttc
ttcgtggacttctggttccaacttgcgcgctggctggacagcacgatcctcgatgcgctc
tacggctggggatttggtgcgaaccggccgcactcaaacttcgatcccttgatcggcctg
aacaatgccttcggcgacatgctgctgaacttcgtcatggcgacgatgtttattgtgctg
cctacgttttgggtggcggctctgtccttggcaggagtacgtgccggcggcatgctccaa
ggtctttcggatgtcacgcggccagcgggtcaagccggaggaaagggggcgggggtcgtg
tcgaacaagctcaggtga

DBGET integrated database retrieval system