KEGG   Cupriavidus necator N-1: CNE_1c27800Help
Entry
CNE_1c27800       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 PrgI DUF3188
Motif
Other DBs
NCBI-ProteinID: AEI78094
UniProt: G0ETP5
Position
1:complement(2884828..2885277)
Genome map
AA seq 149 aa AA seqDB search
MTGYPQNPRQAAQDGLNDGLVVFLPHRLNRHPVVIRGLTADELWACAGLSGVAGFLTGLA
AAWLTQSIAMVPTLVVVGIGIGVFGGGGFLRRKKRGRPDTWLYRQLQWRLALRYPSLAAQ
VGGRQIIAYSGWWTTRREWPSTSIRRGAA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctacccccagaacccgaggcaggctgcgcaggatggtctcaatgatgggctc
gtcgtcttcctgccgcatcgcttgaaccgccatccggtggtgatacgcggattgactgcc
gacgagctgtgggcctgcgccggcttgtccggtgtggccggcttcctgacaggcttggcg
gcggcctggctgacccagagtattgccatggtgccgaccctggtcgtcgttggcatcggg
atcggcgtgttcgggggtggcggcttcctgcgccggaagaagcgcggtcggcctgacacc
tggctataccgccagctccagtggcggctcgcgctgcgctacccctcgctggctgctcaa
gtaggcggacggcagatcatcgcttactctggctggtggaccacacggcgcgagtggcct
tccacatccattcgtcggggcgccgcatga

DBGET integrated database retrieval system