KEGG   Cupriavidus necator N-1: CNE_1c27830Help
Entry
CNE_1c27830       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD DUF3989
Motif
Other DBs
NCBI-ProteinID: AEI78097
UniProt: G0ETP8
Position
1:complement(2885915..2886277)
Genome map
AA seq 120 aa AA seqDB search
MKQTCRRTGAWSRRIVILLLLLSFSSLRAAMASNGAMEREQLGALARQIELADSIAAHAA
NTAMDERARYHFDYARLHADLERVRAGVQDYLAPERAQPRDPVPIAGDYVRSHEPQESSP
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacatgccgacgcactggcgcgtggtcacgccggatagtcatcttgctcctg
ttgctttcgttctcaagtttgcgtgcggccatggcttccaatggcgccatggagcgtgag
caactcggcgccttggcgcgtcagattgaactggcggacagcatcgcagcgcacgccgcc
aacaccgcaatggatgaacgtgcccgctaccacttcgattatgcccggctgcatgctgac
cttgagcgcgtccgtgcaggcgtgcaggactacctcgcccccgagcgtgcccagccgcgc
gatcccgttcccatcgccggcgactacgtacgaagccatgaaccgcaggagtcatcgcca
tga

DBGET integrated database retrieval system