KEGG   Cupriavidus necator N-1: CNE_1c27880
Entry
CNE_1c27880       CDS       T01564                                 

Definition
(GenBank) lytic transglycosylase
Organism
cnc  Cupriavidus necator N-1
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: AEI78102
UniProt: G0ETQ3
Position
1:complement(2890072..2890647)
AA seq 191 aa
MAAAVNPQSALRVALLLVACVWASVAPAQEEPPPAYQIAAKHAGVPSPVLYAVALQESGT
RLRGRLIPWPWTLNVAGRGERYATRAQTCARLRQALTRIPANRIDAGLGQVNLGYQAHRY
SHPCELLDPYRNLAIVAEILMEQYKEGEDWLAAIGRYHRPAGGAPAARYRRSVHQHLVRV
LGPRTTPSAIK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcagcggcagtaaatccgcaatccgcgttgcgtgtcgcgctcctgctagtcgcctgc
gtctgggcatcagttgcgcccgcgcaagaggagccgccgccggcctaccagattgccgcg
aagcacgcaggtgtgccgtcgccagtactgtacgcggtggccttgcaggagagcggcacc
agactgcgtggacggttgattccttggccgtggacactcaatgttgcggggaggggcgag
cgttatgccacgcgggctcagacctgcgcgcgcttgcgccaagcgctcacccgcatccca
gccaaccggatcgacgccggcctcgggcaggtcaatctcggttaccaggcgcatcgctac
agtcatccctgcgagctcctcgacccttacaggaatctcgcgatcgtcgcggaaattctc
atggagcagtacaaagagggcgaggactggctagccgccatcggtcgctaccaccgtcca
gccggcggcgcaccggccgctcgttaccgccgcagtgttcatcagcacctcgttcgcgtg
ctggggccgcgcacaacgccttccgctatcaagtga

DBGET integrated database retrieval system