KEGG   Cupriavidus necator N-1: CNE_1c27890Help
Entry
CNE_1c27890       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEI78103
UniProt: G0ETQ4
Position
1:complement(2890632..2891357)
Genome map
AA seq 241 aa AA seqDB search
MTQVPVAVLAVFLVVGLRGAYAQTAPLVTPRVAQSQLMKSTDAALDERQARDWGLRPEEW
TRYRQLMQGPLGVYSPNLDPLTTLGIEARSDEERNHYAELQVQVEARRVNKTLAYQRAYD
AAWKRLYPGQQRVNLPGAQTLSAGNSGSGRLAVFVRADCAPCDQRVRQLQTAGTEFDVYM
VGSRLDDAYIRQWATRAGIDPARVRARTITLNHDAGRWLSLGVSGELPAVVRELNGRWQR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagtacctgtggccgtccttgccgtgttcctggtagtcggcttacgcggtgca
tacgcacagacagcgccgctggtgaccccgcgcgtagctcagagccagcttatgaaaagc
actgacgccgcgctcgacgagcgccaggccagggattggggcttgcgtcctgaagaatgg
acgcgataccggcaactgatgcaagggccgctgggcgtttattcccccaacctcgatcct
ctcacgaccttgggcatcgaggcacgcagtgacgaggagcgtaaccactacgccgagctg
caggtgcaggttgaggcaaggcgcgtgaacaaaaccctcgcttaccagagggcctacgac
gcggcttggaagcgcctctatccgggccagcagcgtgtcaatctcccgggtgcacagaca
ctgagcgctggtaacagcggttctggtcgcctggccgttttcgtcagggctgactgcgcg
ccgtgcgaccagcgcgtgcgccagttgcagacggcgggcacggagttcgatgtctatatg
gtcggcagccgcctggacgatgcttatatccgccagtgggcgactcgggccggcatcgac
ccggcccgagtccgcgcacgcacgatcacgctcaaccatgatgccggacgttggctgtcc
ctcggcgtgtcgggcgagctgccggccgtggtacgtgagctgaacggcagatggcagcgg
cagtaa

DBGET integrated database retrieval system