KEGG   Cupriavidus necator N-1: CNE_1c27910Help
Entry
CNE_1c27910       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
  KO
K02487  type IV pili sensor histidine kinase and response regulator
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CNE_1c27910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cnc02022]
    CNE_1c27910
   02035 Bacterial motility proteins [BR:cnc02035]
    CNE_1c27910
Two-component system [BR:cnc02022]
 CheA family
  ChpA-ChpB/PilGH [MD:M00507]
   CNE_1c27910
Bacterial motility proteins [BR:cnc02035]
 Pilus system
  Twitching motility proteins
   CNE_1c27910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEI78105
UniProt: G0ETQ6
Position
1:complement(2892017..2892595)
Genome map
AA seq 192 aa AA seqDB search
MRLSAYSLPLAGLAGAVLITGCATTVPPADLTQTPGPPQQSQALISGTNTPGSPVPVVRY
GRYTLTELVAEPGQRDLMKQVVDITIPPSLDSTVGDAMRHVLQRSGYRLCEGSQAVMLYA
LPLPAAHLRLGPMVLRDALLTLAGPAWDMAVDETSRQVCFKHAVAPATTTAEATAVDSLE
GIDRVDNPEVQQ
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtccgcctattctctccctctcgccggtcttgccggggccgtccttatcacg
ggttgtgctaccaccgtaccaccggccgatctgacacagacgcccgggccaccccagcaa
tcccaagcgctgatatccgggacgaatacgccaggcagccctgtgcccgtcgtccgctac
ggccgctacaccttgacggaactggtggcggagccggggcagcgggacctaatgaagcag
gtcgtggacatcaccatcccgccctcgctcgactccacggtcggcgacgccatgcgccat
gtcctccagcggtcgggatatcggctgtgcgagggctcgcaggccgtaatgctgtatgcg
ctgccgttgccggcggctcatctacggttgggaccgatggttctgcgcgatgcgttgctg
acgctcgccggtccggcgtgggacatggccgttgatgaaacctcgcgccaggtttgcttc
aagcacgcggtggcgcccgctaccaccactgccgaagcaacggctgtggattccctcgaa
ggcattgaccgcgttgataatccggaggtgcaacaatga

DBGET integrated database retrieval system