KEGG   Cupriavidus necator N-1: CNE_1c28010Help
Entry
CNE_1c28010       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEI78115
UniProt: G0ETR6
Position
1:complement(2900682..2901059)
Genome map
AA seq 125 aa AA seqDB search
MTTDFFARFEAECLPRIVAAISQHDRRVQLHTLPADAPGWPPRLRVTGDGPPDLRRHQYA
LDITLAWDGLEVQRLFADGGEARFAGYLAALPSKLRAWQEPRGIDFRSLSQVDPQILIGG
LDFEH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccgatttcttcgcccgctttgaagccgaatgcctgccgcgcattgttgccgcg
atcagccagcatgaccggcgcgtgcaactccacacgctgcctgccgatgcccctggctgg
ccgccgcgcctgcgcgtgacgggcgatgggccgccggacctgcggcgccatcagtatgcg
ctcgatatcacgctcgcgtgggacgggctggaggtgcagcggctgttcgcggatggtggc
gaggcgcgctttgccggctacctggcggcgctgccatccaagctgcgtgcctggcaggag
ccgcgcgggatcgatttccgttctctatcgcaggttgacccgcagatcctgatcggcggg
ctggatttcgagcactga

DBGET integrated database retrieval system