KEGG   Cupriavidus necator N-1: CNE_1c28090Help
Entry
CNE_1c28090       CDS       T01564                                 

Gene name
uppP
Definition
(GenBank) undecaprenyl-diphosphatase UppP
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNE_1c28090 (uppP)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CNE_1c28090 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:cnc01011]
 Precursor biosynthesis
  Diphosphatase
   CNE_1c28090 (uppP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: AEI78122
UniProt: G0ETS3
Position
1:complement(2907946..2908827)
Genome map
AA seq 293 aa AA seqDB search
MEIALALKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEKGKIFEIVIQFGAILAVC
WEFRTRIGNVVRGLRADPLAQRFAANVVIASVPAIVLAFIFGKWIKAHLFNPISVALAFI
VGGVVILLAEWRDARRGTVSHPQGNALLEAAKAGAPRIESVDDLNWRDALKVGLAQCFAL
VPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARALLNADDLGIFA
VGFVFAFLSAFLCVRWLLRFVATHDFKPFAWYRIAFGIVVLVTAYSGLVSWHA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgcacttgccctgaaagccgtgatactcggtatcgtcgaaggactgaccgag
tttctgcccatctccagcaccggccacctgatcctggccggccagctgcttgatttcaac
gacgagaagggcaagatcttcgagatcgtgatccagttcggcgcgatcctggcggtctgc
tgggaattccgcacgcgcatcggcaacgtggtgcgcggcctgcgcgccgacccgctggcg
caacgctttgccgccaacgtggtgatcgcctcggtgccggccatcgtgctggcctttatc
ttcggcaaatggatcaaggcccacctgttcaacccgatctcggtggcgctggcctttatc
gttggcggcgtggtgatcctgctggccgaatggcgcgacgcgcgccgcggcacggtctcg
catccgcagggcaatgcactgctggaggccgccaaggccggcgcgccgcggattgaatcg
gtcgatgacctgaactggcgcgacgccctcaaggtcggcctggcgcaatgcttcgcgctg
gtgccgggcacctcgcgctccggtgccaccatcatcggcggcatgctgttcgggctgtcg
cggcaggtggccaccgagttctcgttcttcctggcgatcccggtgatcttcggtgccacc
gtctacgaactgtacaaggcgcgcgcgctgctcaacgccgacgacctcggcatctttgca
gtgggtttcgtctttgccttcctgtccgccttcctgtgcgtgcgctggctgctgcgtttc
gtcgccacgcatgatttcaagccgtttgcctggtaccgcatcgccttcggcatcgtggtg
ctggtgaccgcatactccggcctggtgtcctggcacgcctga

DBGET integrated database retrieval system