KEGG   Cupriavidus necator N-1: CNE_1c28120Help
Entry
CNE_1c28120       CDS       T01564                                 

Gene name
acrR
Definition
(GenBank) transcriptional regulator TetR/AcrR family
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_11 LacI UPF0254
Motif
Other DBs
NCBI-ProteinID: AEI78125
UniProt: G0ETS6
Position
1:2910084..2910899
Genome map
AA seq 271 aa AA seqDB search
MPRRTRKTSVKTPADPHKDADTPRWSRRKAARPQELVAAALDLFVERGYAATRLEDVAAA
AGVSKGTVYLYFANKEELFKSVVRANLVPALARGSDLVDAYDGSTPELLRELLRGWWGLI
GATPVAGLTKLIMAESANFPDIARFYNQEVMVPGDELFAKVLARGVARGEFRAMPANPTT
TLVCAPLVFLMLWQRALRATAEKDINPEAFLDGLLDTLLFGLTTGDARNRPLPPQTGPYI
WERIRDDMLTQRAAAMEADADPDPPAPRPGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgcaggacccgcaagacatccgtgaaaacgcccgccgatccacacaaggacgcc
gacaccccgcgttggagccggcgcaaggccgcccgcccgcaagagctggtggccgcggcg
ctcgacctcttcgtggagcgcgggtatgcggccacgcggctggaagacgtggccgccgcg
gccggcgtgtccaagggcacggtctatctttacttcgccaataaggaagagctgttcaag
tcggtggtacgcgcgaacttggtgccggcactggcgcgcggctccgacctggtcgacgcc
tacgacggcagcacgcccgagctgttgcgcgagctgctgcgcggctggtggggcctgatc
ggcgccacgccggtggcgggactgaccaagctgatcatggccgagtcggccaatttcccg
gacatcgcccgtttctataaccaggaagtgatggtgccgggcgatgagctgttcgccaag
gtgctggcccgcggcgtggcacgcggcgaattccgcgcgatgccggccaaccccaccacg
acgctggtctgtgcgccactggtgttcctgatgctgtggcagcgcgcgctgcgcgccacc
gccgagaaggacatcaaccccgaggccttcctggacggcctgctggacacgctgctgttc
gggctgaccaccggcgacgcccgcaatcgcccgctgccgccgcagaccggcccctatatc
tgggaacgcatccgcgacgacatgctgacgcaacgcgccgccgccatggaagccgacgcc
gaccccgatccccccgcgccgcgacccggcccctga

DBGET integrated database retrieval system