KEGG   Cupriavidus necator N-1: CNE_1c28140Help
Entry
CNE_1c28140       CDS       T01564                                 

Gene name
acrB4
Definition
(GenBank) cation/multidrug efflux pump
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran
Motif
Other DBs
NCBI-ProteinID: AEI78127
UniProt: G0ETS8
Position
1:2912026..2915262
Genome map
AA seq 1078 aa AA seqDB search
MWFTRLSIRNPVLATMMMMAFIVVGLFSYQRLPVDQFPDITFPVVVVQTEYPGAAPESVE
SDVTRKVEEIVNTISGIDEIFSHSYQGTSVVVIKFDLSVDVGQAAQDVRDKIALIRPQFR
DEVKEPRVLRYDPSDAPIFYLSVSNAPGATRSQRELTTIADQIVRKRLETVRGVGAINIV
GGTKREVEIRIRPAQLEALGIGVDQVMNAIRNENQELPAGELRSSATETVVQIKGRVPTP
EAFRQIIVARRAGQPVTLGEIADVRDGQEEQESLALLDGKRALFLSVVKAQGQNTVDTVD
GLVRMTEETRKLVPAGVQLNVVNDTARGIRSSVKEVRSTLLEGAFLTVAIVFLFLGSWRS
TVITGLTLPIALIGTFGVMYMCGFTLNVITLMALSLCVGLLIDDAIVVRENIVRHNLMGK
DHRTAALDGTNEIGLAVLATTFSIVAVFLPVGFMGGIIGRFFHQFGITVVAAVLISMFVS
FTLDPMLSSVWHDPDLHGTGNKKSWYGRTVGRLLDWFSAKMDKLGNGYAGMLGWALKHRL
ATAIIAAVTFFGSFALVPLIGTEFVPNADLGETQVGFTTPVGTSIEVTEAKVRQVEAALK
SFPEVAYTYATINSGNASGRNNALVSVRLTERRSRQLSTAQLNPLIRQRLAGIAGITLTM
VGMPDGAGGQKAIQVSIQGDDLDELRRLSREAGTRMKAIRGLADLDSSMKDDRPTIEVRI
RRELASDLGVGVAQIGNALRPLLAGDAISSWRAPDDENYDVRVRLPKDARTGMADLSALM
IASSQTNADGSPRMVPLRQIAELVPTTGANQISRRDLNREVELTANVAGRSAGEVARDVK
AALDGMNWPAGYKYRFGGSTKSMNESFGYAVSALALAVIFIYMILASQFASFFQPIAIMT
SLPLTLVGVFAALLLFRSTLNMFSIIGFIMLMGLVTKNAILLVDFANQARQGHVDGADGR
QPLSREAALVEAARVRLRPILMTTLGMIFGMVPLAFSLGEGAEQRAPMGQTVIGGIITSS
ILTLVVVPVIYTYLDDFGAWLRRLWQGKAASGPAAHAPPAPGRQAAPDRPAPADASAE
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcacccgcctgtcgatccgcaacccggtgctggccaccatgatgatgatggcc
ttcatcgtggtggggctgttctcttaccagcggctgccggtcgaccagttccccgacatc
accttcccggtggtggtggtgcagaccgaatacccgggcgccgcgcccgagtcggtggag
tccgacgtcacgcgcaaggtcgaggagatcgtcaacaccatctctggcatcgacgagatc
ttctcgcattcgtaccagggcacctcggtcgtcgtcatcaagttcgacctgagcgtcgac
gttggtcaggccgcgcaggacgtgcgcgacaagatcgcgctgatccgcccgcagttccgc
gacgaggtgaaggaaccacgcgtgctgcgctatgacccgtccgacgcgccgatcttctat
ctctcggtctccaacgcaccgggcgccacccgaagccagcgcgagctgaccaccatcgcc
gaccagatcgtgcgcaagcggctggagacggtgcgcggcgtgggcgccatcaatatcgtg
ggcggcaccaagcgcgaggtcgagatccgcatccggcccgcgcagctggaagcgctgggg
atcggcgtggaccaggtgatgaacgccatccgcaacgagaaccaggaactgcccgcgggc
gagctgcgttcctcggccacggaaacggtggtgcagatcaagggccgcgtgcccacgccg
gaggcgttccgccagatcatcgtggcgcgccgcgccggccagccggtcacgctgggcgag
attgccgatgtgcgcgacggccaggaagagcaggaaagcctggcactgctggacggcaag
cgcgcgctgttcctgtcggtggtgaaggcacagggccagaacaccgtcgataccgtcgac
ggcctggtgcgcatgaccgaggaaacacgcaagctggtgccggctggcgtgcagctgaac
gtggtcaacgacaccgcgcgcggcatccgcagcagcgtcaaggaggtgcgatcgacgctg
ctcgaaggcgccttcctgacggtggcgatcgtgttcctgtttctgggttcgtggcgcagc
accgtgatcaccgggctgacgctgccgattgcgctgatcggcaccttcggcgtgatgtat
atgtgcggcttcacgctcaacgtgatcacgctgatggcgctgtcgctgtgcgtgggcctg
ctgatcgacgacgccatcgtggtgcgcgaaaacattgtgcgccacaacctgatgggcaag
gaccaccgcaccgcggcgctggacggcaccaatgagatcgggctggcggtgctggccacc
accttctcgatcgtggcggtgttcctgccggtgggcttcatgggtggcatcatcgggcgc
ttcttccaccagttcggcatcaccgttgtcgcggcggtgctgatctcgatgttcgtctca
ttcacgctggacccgatgctgtcgtcggtctggcacgacccggacctgcacggcaccggc
aacaagaagagctggtacgggcgcacggtggggcggttgctggactggttctcggcaaag
atggacaagcttggcaacggctatgccggcatgctgggctgggcgctgaagcaccggctg
gccaccgccatcatcgccgcggtgaccttcttcggcagctttgcgctggtgccgctgatc
ggcactgaattcgtgcctaatgccgacctgggcgagacccaggtgggcttcaccacgccg
gtgggcacctcgatcgaagtcaccgaagccaaggtgcggcaggtggaagccgcgctgaaa
tccttccccgaagtggcctacacctacgccaccatcaactcgggcaatgcctcgggccgc
aacaacgcgctggtgtcggtgcgcctgaccgagcggcgctcgcgccagctgtccaccgcg
cagctcaacccgctgatccggcagcgcctggcgggcattgccggcatcacgctgaccatg
gtgggcatgcccgacggcgccggcggccagaaggcgattcaggtatcgatccagggcgat
gacctggacgaactgcggcgcctgtccagggaagcgggcacacgcatgaaagcgatccgc
ggcctggccgacctggactcgagcatgaaggacgaccgccccaccatcgaggtgcgcatc
cggcgcgagctggcctcggacctgggcgtgggcgtggcgcagatcggcaacgccctgcgc
ccgctgctggccggcgacgccatcagctcatggcgcgcgcccgatgacgagaactacgac
gtgcgcgtgcgcctgcccaaggacgcgcgcaccggcatggccgacctgagcgcgctgatg
atcgcgagcagccagaccaacgccgacggctcgcccaggatggtgccgctgcgccagatc
gccgagctggtgccgaccaccggcgccaaccagatcagccggcgcgacctgaaccgcgag
gtcgagctgaccgccaacgtggccgggcgctctgccggtgaagtcgcacgcgacgtcaag
gccgcgctggacggcatgaactggccggccggctacaagtaccgctttggcggctcgacc
aagtcgatgaacgagtccttcggctacgccgtgtcggcgctggcactggcggtgatcttc
atctacatgatcctggcctcgcagttcgccagcttcttccagccgatcgccatcatgacc
tcgctgccgctgacgctggtcggggtgttcgcggcgctgctgctgttccgctcgacgctg
aacatgttctcgatcatcggcttcatcatgctgatggggctggtgaccaagaacgcgatc
ctgctggtggacttcgccaaccaggcgcgccagggccatgtcgacggcgccgacggccgc
cagccgctgtcgcgcgaggcggcgctggtggaggccgcgcgcgtgcggctgcgccccatc
ctgatgaccacgctgggcatgatcttcggcatggtgccgctggccttcagcctgggcgaa
ggcgccgagcagcgcgcgccaatgggccagaccgtgatcggcgggatcattacctcgtcg
atcctgacgctggtggtggtgccggtgatctatacgtatcttgatgatttcggggcctgg
ctgcgccggctgtggcaaggcaaggcggccagcgggcccgcagcgcacgccccgcccgca
cccggccggcaagcggctccggaccggccggccccggcggacgccagcgcggaatga

DBGET integrated database retrieval system