KEGG   Cupriavidus necator N-1: CNE_1c28190Help
Entry
CNE_1c28190       CDS       T01564                                 

Gene name
rfaL
Definition
(GenBank) membrane spanning protein involved in lipopolysaccharide biosynthesis
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00540  Lipopolysaccharide biosynthesis
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CNE_1c28190 (rfaL)
Enzymes [BR:cnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CNE_1c28190 (rfaL)
Lipopolysaccharide biosynthesis proteins [BR:cnc01005]
 O-antigen
  CNE_1c28190 (rfaL)
Transporters [BR:cnc02000]
 Other Transporters
  Others
   CNE_1c28190 (rfaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-ProteinID: AEI78132
UniProt: G0ETT3
Position
1:2919207..2920496
Genome map
AA seq 429 aa AA seqDB search
MLLMTRLQRSQSYGVDKALYLAACAVLAAFPALMFVKPTVSNLCYGLLLGWSAITLVAGG
RAGRAECGALLRRYWLFMLAMAALPLAVLLQQLLAGAEEPHVSYLYLRFALFIPLVFGMV
RLGRGGMRSVQWGFVVCALLSAAWIHEATAAGRPAHVGFSNIIPLSNLSMLMGILALISI
GWDRPRGYLQSGLKLLAGSAGLYASYTSGTRGGWLAIPVLALIALAASRRLTRVHKVAAL
AGLAGLMVLTWFGSPFVQQRTTDVVSELSQFDHHVTLDTSIGIRLQLWRTSLQMVQAHPW
TGVGPDNYEQALQALAAQHVITAEAATMPHTHNDILHAAATLGIPGLLAVLMLYLVPAAF
FLRHLRNDDRDTQVASAMGLALCCGFMVFGLTEVMFATTLVNAFYSLIMAVCFAYVVARK
DALPAQAAS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgatgacgagattgcagagatcccaatcgtatggggtcgacaaagctctgtac
ctggccgcctgtgccgtcctggctgcgttccctgcgctgatgtttgtcaagccgacggtt
agcaacctctgctacggactcctgctcggctggagcgccatcactctcgttgccggcggg
cgcgcgggccgggcggaatgtggcgcgctgctgcgccgatactggctgttcatgctggcc
atggcggcgctgccgcttgcggtgctgttgcagcaactgctggccggggcggaggagccg
catgtttcttacctgtacctgcgctttgcattgttcattccgttggtttttgggatggta
cggcttggcaggggtgggatgcggagtgtgcagtggggtttcgtggtctgcgcactcctt
tccgccgcttggatccacgaggcgacagctgccggtcgcccagctcacgtagggttctcc
aatatcattccccttagcaatctgtccatgctgatgggaattctcgccctgatttcaatt
ggatgggatcgccccaggggctatctgcagtcgggcctgaagctgctggccggctctgct
ggcctgtacgcctcatacaccagcggcacgcgtggcggctggctcgcaatccccgtgctg
gcgctgattgcgttggcagcatcacgcagattgacccgcgtacacaaggtggccgcactg
gctggactggctggtctcatggtcctcacgtggttcggcagcccctttgtgcagcagcgc
acgacagacgttgtatccgaactgtctcaatttgatcaccatgtaacactggacacgtcg
atcgggatacggctacagctgtggcgaacatcgctccagatggtgcaggcccatccctgg
accggcgtggggccggacaactatgaacaggctctgcaggccctggcggcacagcacgtg
attaccgctgaggccgccaccatgccgcacacccacaatgacatcctgcacgcggcggcc
acactcggcataccagggctgctggcagtgctcatgctgtatcttgtgccagccgccttc
ttcctgcgccacctgcgcaatgacgatcgggatacacaagtcgccagcgccatgggccta
gccctgtgctgcggcttcatggtgttcggcctgaccgaggtcatgttcgccacgaccctg
gtcaatgccttctacagcctgatcatggccgtgtgcttcgcctacgtggttgcgcgcaag
gacgccttgcccgcgcaggcggccagttga

DBGET integrated database retrieval system