KEGG   Cupriavidus necator N-1: CNE_1c28200Help
Entry
CNE_1c28200       CDS       T01564                                 

Gene name
rfaG
Definition
(GenBank) glycosyltransferase RfaG
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AEI78133
UniProt: G0ETT4
Position
1:2920493..2921584
Genome map
AA seq 363 aa AA seqDB search
MSQGSRQHICFLTGTLNAMAGAERMTATIANALADLGHHVTILSLWDATSQFPLHPRVRH
VALYAQRPSFKRAYFGTVSGIRRHCTAHRIDVLVQVDTMLELFVLPATLGLGLHHIAWEH
CHFDEDLGRPARKVARRLAAQFCRQVVVLTERDRRRWLEALRPRSEVVCLPNPLPFPMPA
EPAPRMQKTVLAMGRLVPAKGFDVLLRAWQKVVEAEPEWQLVIHGEGEERPALTALIGQL
QLQDRASLPGICQDPAQAYGRASVFCLSSRYEGFGLVLIEAMAFGLPIVSTDCETGPREL
LTPGQDALVVAADDADALAKALLTVIRQPELASRLGAGGRHKASHFTLERLALQWDALVK
APG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagggctcacgacagcacatctgcttcctgaccggtaccttgaatgcgatggcc
ggcgcggaacggatgaccgcaacgatcgccaatgcgctggccgaccttggccatcatgtc
accatcctgagcctctgggacgctaccagccagtttccgttgcatccgcgcgtgcgccat
gtagcgctgtacgcgcaacggccctccttcaaacgcgcctatttcggcacggtttccggc
atccgcaggcactgcaccgcgcatcgcatcgatgtgctggtacaggtcgacaccatgctc
gaactgttcgtgctgcctgccaccctcggcctgggcctgcaccatatcgcgtgggagcat
tgccatttcgacgaggatctcggcaggccggcgcgcaaggtggcacggcgactggccgcg
cagttctgccggcaggtagtcgtgctgacagagcgggaccgccgccgctggcttgaggca
ctgcggccgcgcagcgaggtcgtctgcctgccgaatccgctgccatttccgatgccggcc
gaacccgcgccacgcatgcagaagaccgtgctggccatgggccggctggtcccggcgaaa
ggctttgatgtcttgctgcgcgcctggcagaaggtagtggaagcggaaccggaatggcaa
ctggtcatccacggcgaaggcgaagagcgccctgccctcactgcactgatcggccagctg
caactgcaagaccgggccagcctgccgggtatctgccaggatccggcgcaggcctacggg
cgtgcatcggtcttctgcctgagttcgcgctatgagggattcggactggtgctgatcgaa
gcgatggcctttggcctgccgatcgtatcgaccgattgcgagaccggaccccgcgaactg
ctcaccccggggcaggatgcgctggtggttgcagcggatgatgccgatgcgctggccaag
gcgctgctgacggtaatccgccaaccggaactggcgagccgccttggcgccggtggccgc
cacaaggcaagccatttcacgctggagcggcttgccctgcagtgggatgccctggtcaag
gcaccagggtaa

DBGET integrated database retrieval system