KEGG   Cupriavidus necator N-1: CNE_1c28230Help
Entry
CNE_1c28230       CDS       T01564                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase ManB
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00030  Pentose phosphate pathway
cnc00051  Fructose and mannose metabolism
cnc00052  Galactose metabolism
cnc00230  Purine metabolism
cnc00500  Starch and sucrose metabolism
cnc00520  Amino sugar and nucleotide sugar metabolism
cnc00521  Streptomycin biosynthesis
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c28230 (manB)
   00030 Pentose phosphate pathway
    CNE_1c28230 (manB)
   00051 Fructose and mannose metabolism
    CNE_1c28230 (manB)
   00052 Galactose metabolism
    CNE_1c28230 (manB)
   00500 Starch and sucrose metabolism
    CNE_1c28230 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    CNE_1c28230 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    CNE_1c28230 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CNE_1c28230 (manB)
Enzymes [BR:cnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CNE_1c28230 (manB)
    5.4.2.8  phosphomannomutase
     CNE_1c28230 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEI78136
UniProt: G0ETT7
Position
1:complement(2923969..2925354)
Genome map
AA seq 461 aa AA seqDB search
MQIDPTIFKAYDIRGIVGKTLTRDVARQIGLSFGSAATELGEKTIAVGRDGRLSGPDLIS
GLVEGLRAAGLDVIDIGLVATPMVYFATNIEIDGVRPTSGIMVTGSHNPPDYNGFKMVLA
SKAIYGEQIQALRQRIEAGNFTSGAGTYKQVDVRQKYLDRIISDVKLARPMKVALDAGNG
VAGAFVGDLFRGLGCEVTELFCDVDGNFPNHHPDPAHIENLQDLMKALRETDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILSRNPGAQVIYDVKCTGKLAPWIREHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHADPSAV
LNALPNANNTPELQLKCAEGEPFTLLDRIKANAKFDGAREVITIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAQLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgatcccaccatttttaaagcctacgacattcgcggaatcgtgggtaagact
ctcacgcgcgacgttgcgcgccagatcgggctgtcgttcggttcggcggcgactgaactg
ggcgaaaaaaccatcgccgtaggccgcgacggccgcctctccggccccgacctcatctcc
ggcctggtcgaaggcctgcgcgccgccggcctggacgtgatcgacatcggcctggtcgcc
accccgatggtctacttcgccaccaacatcgagatcgacggcgttcgcccgacctccggc
atcatggtcaccggcagccacaacccgccggactacaacggtttcaagatggtgctggcc
agcaaggcgatctatggcgagcagatccaggcgctgcgccagcggatcgaagccggcaat
ttcaccagcggtgccggcacctacaagcaagtcgatgtgcgccaaaagtacctcgaccgc
atcatcagcgacgtcaagctggcccgtccgatgaaggttgccctggatgccggcaacggc
gtggccggtgccttcgtgggtgaccttttccgtggactgggctgtgaggtgactgagctg
ttctgcgacgtggacggcaacttcccgaaccaccaccctgatcccgcacatatcgagaat
ctgcaggatctgatgaaggccctgcgcgagactgactgcgagcttggcctggccttcgac
ggcgatggcgaccgccttggtgtggtgaccaaggacggtcaggtgattttcccggacagg
caactgatgctgttcgctgaagagatcctgtcgcgcaacccaggtgcccaggttatttac
gacgtgaaatgtaccggcaagctggccccctggatccgagaacacggcggcgagccgctg
atgtggaagaccggccattcgctggtcaaggccaagctgaaggaaacgggcgcgccgatc
gcgggcgagatgagcggtcacgtgttcttcaaggaccgctggtacggctttgacgatggc
ctgtacacgggtgcgcgcctgttggagatcctgtcgcgccacgcggatccgagcgcggtg
ctgaatgcgctgccgaatgccaacaacacgccggaactgcagctcaagtgtgccgagggc
gagccgttcacgctgctggaccggatcaaggcgaacgcgaagttcgacggggcgcgcgag
gtgatcaccatcgacggcgtgcgcgtggaatatgccgatggcttcggcctggcgcgcccg
tccaacaccaccccggtggtggtgatgcgtttcgaggcggacaacgacgccgcgctggca
cgtatccaggcggagttcaagcgcgtgatcctggcagagaagccggatgctcagctcccg
ttctga

DBGET integrated database retrieval system