KEGG   Cupriavidus necator N-1: CNE_1c28250Help
Entry
CNE_1c28250       CDS       T01564                                 

Definition
(GenBank) UDP-galactose-lipid carrier transferase, undecaprenyl-phosphate galactose phosphotransferase
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf
Motif
Other DBs
NCBI-ProteinID: AEI78138
UniProt: G0ETT9
Position
1:2926800..2928125
Genome map
AA seq 441 aa AA seqDB search
MMHSTKTDTLPRHAVRRRIAGSETIRRISRMLAWAALGLALFAVNAALAELAHRAGFVTH
VFTRTLLWSIVPYLAGFMLLHRSLHLPAMEGNSLVGLAATLPFVALLFVFAAFHIEYSRG
AMLLAYIITLGWTWLGYRRFVQNYVPLFGYTDPHALEQLDTILAMPGAAPAAHMRFELIR
SLEDAKHCDGLMLDRGATADPERTRQLAQYKMSDVRMYSVERVGEMLTGRVGLSHIDENF
LDDYAAHYLYGYLKRAVDILAVLCLAPFVLPIGLAVALAIRMETPGGAIFRQSRVGLFGK
PFVMLKFRSMGVDKSAPAQFAARRDPRVTRVGRIIRKYRLDEIPQLWNVLIGQMSFIGPR
PEQVPMVEQFSETIAYYPYRHLVRPGLSGWAQVQQGYAGSHEETVTKLSYDLYYVKHCSL
ALDMLIALKTMRTLLTGYGAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattcgaccaagaccgacaccctgccccgtcacgcggtccgccggcgcatcgcc
ggctccgaaaccattcgccgcatcagccggatgctggcatgggcggcgctgggactggcc
ttgtttgcagtcaacgcggcgctggcggagctggcccatcgggccgggttcgtgacccac
gtgtttacgcgcacgctgctgtggtcgatcgtgccatatctggccggtttcatgctcctg
catcgctcactgcacctgccggcgatggaagggaacagccttgtcgggctggccgccacg
ctgccattcgtagcgcttctattcgtcttcgctgcattccatatcgaatattcccgcggc
gccatgctgctcgcctacatcatcacgctgggttggacctggctgggctaccgccgtttc
gtgcagaactacgttccgctgttcggctataccgacccccatgcgctagagcaactggac
accatactggccatgcccggtgcagcaccagctgcgcacatgcgattcgaactcatccgc
tccctggaagacgccaagcattgtgacgggctgatgctcgaccgaggcgccacggcagac
ccggagcgcaccaggcagctcgcccagtacaagatgagcgacgtgcggatgtactccgtg
gagcgcgttggcgagatgctgaccggacgggttgggctatcccacatcgatgagaacttc
ctcgatgactacgccgcccattacctctatggttatctcaagcgagccgttgatatcctt
gccgtgctttgcctggcaccatttgtcctacccatcggcctggccgtggcattggcgatc
cggatggaaacaccaggcggcgccatcttccgccagtcacgcgtgggcctgtttggcaag
ccgtttgtcatgctcaagttccgcagcatgggcgtcgataaaagcgccccggcacagttc
gccgcgcggcgcgatccgcgtgtcacgcgtgtgggccgcatcatccgcaaataccggctc
gacgagattccacaactgtggaacgtcctgatcggccaaatgagtttcattggaccccgg
ccggaacaggtgccgatggtcgagcaattctcggaaacgattgcttactacccctaccgt
cacctggttcgtcccgggctatccggctgggcgcaggtacaacagggatacgccggtagt
catgaagaaacggtgaccaagctgagctacgacctgtactacgtcaagcactgctcgctg
gcactggatatgctgatcgcgctgaagacaatgcgtacgctgttgacaggctacggggcc
cgctga

DBGET integrated database retrieval system