KEGG   Cupriavidus necator N-1: CNE_1c28290Help
Entry
CNE_1c28290       CDS       T01564                                 

Gene name
wecA
Definition
(GenBank) undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase WecA
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     CNE_1c28290 (wecA)
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     CNE_1c28290 (wecA)
Glycosyltransferases [BR:cnc01003]
 Polysaccharide
  Bacterial polysaccharide
   CNE_1c28290 (wecA)
Lipopolysaccharide biosynthesis proteins [BR:cnc01005]
 O-antigen
  CNE_1c28290 (wecA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: AEI78142
UniProt: G0ETU3
Position
1:complement(2932133..2932969)
Genome map
AA seq 278 aa AA seqDB search
MGVIDDMKGMSPVAKLGAQLLAAILMTSWGGIYLGTLGDIFGRREIELGNWGIPLTLFAA
VAVINAMNMCDGLDGLAGGLAAITFAWFAYLAGQVDNGAAQRMCVIFCGAILGFLLFNMK
NPFRGGKKVFLGDAGSLMLGFSIVWFAVLLSQRGYNADRQIPPVVMLWVLGFVLIDLFTV
VVRRVLKGKNPLAADRTHLHHVLLRLGLGPDAIVWVILVSNAIFGFCGVYGWKAGYSEQT
LFILFLGLVLVHLMIMRNAWRLIRVGRRIVVRLTRKSY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtcatcgatgatatgaagggaatgtcgccggtggcgaagcttggagctcagttg
ctggcggccattctgatgacatcatggggtggaatttatcttggtacgcttggagatatt
tttggtcgcagagaaattgaactgggtaattggggaattcctctgacactctttgcagcc
gtcgccgtaattaatgccatgaatatgtgtgacggtctggacggcttggcgggagggcta
gccgccatcacatttgcgtggttcgcatatttggcagggcaggtcgataatggtgccgct
caacgcatgtgcgtaatattctgcggtgccattcttggttttctcttgttcaatatgaag
aatccatttcggggaggaaaaaaggtctttctgggggatgccggtagtttaatgctgggg
ttcagtatagtgtggttcgcggttcttctctcgcagcgtggctataacgcggatcgacaa
atacctcctgtggtgatgttatgggtacttggatttgtcctgattgacctcttcactgtg
gtagtgcgacgggtactgaagggcaagaacccgctggcggcggataggacacatcttcat
cacgtgctgctcaggctagggctagggcctgacgcaattgtctgggtcatcctggtcagt
aacgctatatttgggttttgcggcgtatatggctggaaagcaggatattctgaacagacg
ctatttattctctttcttgggctagtccttgttcacttgatgatcatgcgcaacgcgtgg
cgcttgatacgagtaggccgtcgtattgtggttagattgacgcgcaaatcctattga

DBGET integrated database retrieval system