KEGG   Cupriavidus necator N-1: CNE_1c28320Help
Entry
CNE_1c28320       CDS       T01564                                 

Definition
(GenBank) hypothetical membrane protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox FAD_oxidored Pyr_redox_2 NAD_binding_8 NAD_binding_9 FAD_binding_2 TM1506 Sacchrp_dh_NADP TrkA_N Pyr_redox_3 NAD_Gly3P_dh_N MCRA
Motif
Other DBs
NCBI-ProteinID: AEI78145
UniProt: G0ETU6
Position
1:2934781..2935941
Genome map
AA seq 386 aa AA seqDB search
MASVRTIYDAVIIGGGFYGAAIAVYLAQQRGLKQILLVEREPALLSRASYSNQARVHNGY
HYPRSFTTAYRSRINLPRFVRDWPQAVKQDFTKLYAIARRNSKVSSRQFQRFCQEIGARI
EPAGPTLRNLFAPRLIEDVFLVEEYAFDTRRLAEWARRELEEHGVEVCCETVVSAISRSD
PGLCAVEMHDRAGNGRVVKSANVFNCTYSGLNQFGGDFPGTRTELKQEITEMALVDAPAG
LKDIGITVMDGPFFSMMPFPARGLHTLSHVRYTPHLHWDDCGGVSPYDRLAAYDKASRVD
RMIRDVSRYVPLVAEARHIDSLFEIKTVLRKNEGDDGRPILFEKHAELPGCYSILGGKID
NIYDVLERLDDETLTPAPASLSKSNI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgtgcgcaccatttacgatgcggtcatcatcggcggagggttttacggcgca
gccattgccgtctatctcgcgcagcagcgcggactgaagcagatcctgctcgtcgagcgc
gagccggcattgctatctcgcgcctcctatagcaaccaggcgcgcgtccacaacgggtac
cactatccgcgcagcttcacaacggcctaccggagccggatcaaccttccacgcttcgtc
cgtgactggccgcaggcggtcaagcaggatttcaccaagctgtatgccattgcccggcgc
aactccaaggtcagctcacgccagtttcagcgcttctgccaagaaatcggcgcccggatc
gagcctgccggtccgacgctgcgcaacctgttcgcaccgcggctgatcgaagatgtgttc
cttgtcgaagagtacgcgttcgacactagacggctcgcggaatgggcacgtcgtgaacta
gaggagcacggcgttgaagtctgctgcgagaccgtggtcagcgccatttcgcgcagcgac
cccggactctgcgccgttgaaatgcatgaccgcgcggggaatggacgcgtggtcaagagc
gccaacgtcttcaattgcacgtacagcgggctgaaccagtttggcggagactttccgggc
acccggacggagctgaagcaggaaatcacggagatggcgctggtggatgcaccggccggc
ctgaaggatatcggcatcactgtcatggacggcccattcttctcgatgatgcccttccct
gcgcgcggcttgcacacactttcgcacgtgcgctataccccgcatctgcattgggacgac
tgtggtggtgtcagtccctacgaccgactcgcggcatatgacaaggcctcacgcgtggac
cgcatgattcgcgacgtttcgcgctatgttcctttggtcgccgaagcgcgtcacatcgat
tcgctgttcgagatcaagaccgtcctgcgcaagaacgagggggacgatggcaggcccatc
ctcttcgagaagcacgcggaactgcctggctgttattcgatcctcggcggcaagatcgac
aacatctacgacgtccttgaaagactggatgacgaaacactcactccggcgcccgcctca
ctgagcaaaagcaacatatga

DBGET integrated database retrieval system