KEGG   Cupriavidus necator N-1: CNE_1c28330Help
Entry
CNE_1c28330       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AEI78146
UniProt: G0ETU7
Position
1:2935938..2936726
Genome map
AA seq 262 aa AA seqDB search
MNNALIGFSGFVGTTLLRQAPFEALYRSTNIGEIDGKDFDTVVCAGAPAQKWIANREPAA
DREKIEALIAHLRTVSCKTFVLISTVDVFKTPVGVDESSPVDKSGLHAYGLHRLMLEEFV
ASHFANHLIVRLPGLIGPSLRKNVIFDFLNDNNLHAIDSRGVFQFYPMVNLWYDIEVALH
AGLKLVHLTAAPISVADVSAQGFGKPFEQVVGDNATRYDLRTRHAAVFGASGVYQYDQRA
TLQAVRAYAQSEPRTLKAGSGA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgcactgatcggcttctcgggcttcgttggcacgacgcttcttaggcaagcc
cctttcgaggccttgtaccgctcgaccaatattggcgagatcgatggcaaggactttgac
acggtggtctgtgccggcgcgcccgctcaaaaatggatcgcaaatcgcgagccggcagca
gaccgtgaaaaaatcgaagcgctcatcgcccaccttcgcacggtctcatgcaagacgttt
gtcctgatcagcactgtcgatgtgttcaagacgccggtcggcgtcgatgaaagctcgccg
gtggacaagagcggattgcatgcctatggcctgcaccgcctaatgctcgaggaattcgtc
gccagccatttcgcgaaccatctgatcgtccgcctgcctggcctgatcggtccgagcctg
cgcaagaacgttatcttcgacttcctgaacgacaacaacctgcacgcgatcgacagtcgt
ggcgtcttccagttctacccgatggtcaatctctggtacgacatcgaagtcgcgttgcac
gcgggcctaaaactagttcacctgaccgccgcaccaatcagtgtcgcggacgtgtcggct
cagggcttcggcaagccgttcgagcaggtggtgggtgacaatgccacccgctatgacttg
cgcacgcgccacgcggcagtgttcggtgcctcgggcgtataccaatatgaccaacgtgcg
acgctgcaggcggtccgcgcatacgcccagtccgagccgcgcaccttgaaggccgggagc
ggggcatga

DBGET integrated database retrieval system