KEGG   Cupriavidus necator N-1: CNE_1c28340Help
Entry
CNE_1c28340       CDS       T01564                                 

Definition
(GenBank) xylose isomerase
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEI78147
UniProt: G0ETU8
Position
1:2936723..2937559
Genome map
AA seq 278 aa AA seqDB search
MRIAISNIAWDVAEDESVAALLHKFGVDAIDVAPGKYFPDPEHASDADIARVRDQWKAHG
IELTGMQSLLFGTSGLNLFGSSAARSAMLHRLAAVARIGGKLGATRLVFGSPRNRDRGAL
DDREVTEIAVPFFRELGDIAHGHGVTFCLEPNPVCYGANFMTTSAETVNMVRLVAHPAIR
MQFDTGSLAINGEDPADVLEHNADLIGHVHASEPQLVPLGDGTTDHAAMAAQLATHLPGH
VVSIEMVAKANEPHLPAIQRALATAQRWYRQAPGVPLA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgctatctcgaacatcgcctgggatgtcgccgaagacgagtctgtggcggcg
ctgttgcacaagttcggcgtcgacgcgatcgacgtagcccctggcaaatatttcccggat
cccgaacatgcgagcgatgccgacatcgcgcgggtgcgcgatcagtggaaggcacacggg
attgagctgaccggcatgcaatcgctgctgttcggtacttccgggctcaatctgttcggt
tcgtcggcagcgcgctcggcgatgctgcatcgcctcgccgccgtagcacggatcggcggc
aaacttggcgcgacccgactggtattcggctcgccaaggaatcgggatcgcggcgccctt
gacgatcgtgaggttacagagattgccgtgccgttttttcgcgagctgggcgacattgcg
catggccacggcgtgacgttctgcctcgagcccaacccggtgtgctacggcgcgaatttt
atgaccaccagcgcagagaccgtgaacatggtgcggctggtcgcccatccggctatccgc
atgcagttcgacaccggatcgctggccatcaatggggaagaccccgccgacgtgctggag
cacaacgccgatctgatcggtcatgtccacgccagcgagccccagctggttccgctgggt
gatggcacgaccgaccacgctgccatggctgcacaactagccacgcacctgcccggacac
gtcgtctccattgaaatggtagccaaggcgaacgagccgcaccttccagccatccaacgc
gcgctggcgacagcccaacgctggtatcggcaagcaccaggagtcccactcgcatga

DBGET integrated database retrieval system