KEGG   Cupriavidus necator N-1: CNE_1c28350Help
Entry
CNE_1c28350       CDS       T01564                                 

Gene name
emrE
Definition
(GenBank) multidrug efflux transporter protein EmrE
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res TMEM234 EamA TPT UAA
Motif
Other DBs
NCBI-ProteinID: AEI78148
UniProt: G0ETU9
Position
1:2937556..2937912
Genome map
AA seq 118 aa AA seqDB search
MKWLILILGIASNASASVLVKMAMIPPRRFPSLSEPLAAFTNWPFWVGLGLYGAAFLLYA
AALARLPLNVAHPVLTSGAVATVATLSVLIFREPFHWTTGAGILLVIAGVVLITAKVA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggctgattctgattctaggcatcgccagcaacgcatcggccagcgtactggtc
aagatggcgatgattcccccccgcagatttccctcgctaagtgaaccgctcgccgccttc
accaactggccattctgggtcggcctcggcctgtatggcgcagcctttctgctctatgcc
gcggcgcttgcccggctgccgctcaacgtcgcccaccccgtcctgacatcgggggccgtg
gcgacggtagcaacgctttcggtgctcatcttccgcgagccttttcactggactaccggc
gcgggcatcctgcttgtcatcgcgggcgtcgtcctgatcaccgccaaggtggcctga

DBGET integrated database retrieval system