KEGG   Cupriavidus necator N-1: CNE_1c30580Help
Entry
CNE_1c30580       CDS       T01564                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00480  Glutathione metabolism
cnc00590  Arachidonic acid metabolism
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CNE_1c30580
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNE_1c30580
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNE_1c30580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEI78370
UniProt: G0EVU2
Position
1:complement(3182343..3182873)
Genome map
AA seq 176 aa AA seqDB search
MAVCLGYLEESAMSNVYQFEANSLAGQPVPLSQFQGKVMLVVNTASECGFTPQYEGLQKL
YDEYHGRGLEVLGFPCNQFGKQEPGDAQQIGQFCETRFAVRFPMFAKVDVNGADAHPLYQ
WLTTEKRGVLGTQGIKWNFTKFLLRRDGTVFKRYAPTTKPDELRADIEKLLSDPAA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcggtatgcttgggctacctagaggagtctgccatgagcaatgtctaccagttcgaa
gccaactcgctggccggccagccggtaccgctgtcgcagttccagggcaaggtgatgctg
gtcgtcaacaccgccagcgaatgcgggttcacgccgcagtacgagggcctgcagaagctc
tatgacgaataccacgggcgcggcctggaggtgctgggcttcccgtgcaaccagttcggc
aagcaggagccgggcgatgcgcagcagatcggccagttctgcgaaacgcgctttgcggtg
cgcttcccgatgttcgccaaggtcgacgtgaacggcgccgacgcccatccgctgtaccag
tggctgaccacggaaaagcgtggcgtgctcggtacccagggcatcaaatggaacttcacc
aagttcctgctgcgccgcgacggcacggtgttcaagcgctatgcgccgaccaccaagccc
gacgagctgcgcgccgatatcgagaagctgctgtccgacccggctgcctga

DBGET integrated database retrieval system