KEGG   Cupriavidus necator N-1: CNE_1c34200Help
Entry
CNE_1c34200       CDS       T01564                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CNE_1c34200 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cnc03011]
    CNE_1c34200 (rplV)
Ribosome [BR:cnc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CNE_1c34200 (rplV)
  Bacteria
    CNE_1c34200 (rplV)
  Archaea
    CNE_1c34200 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10 DUF5610
Motif
Other DBs
NCBI-ProteinID: AEI78723
UniProt: G0EYS7
Position
1:complement(3562668..3562997)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLQFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIFVDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcgattcatcgcggtgcccgcatctccgcccagaagacgcgcctggtc
gctgaccagatccgtggtctgccgatcgagcgcgcgctcaatgtcctgcagttcagcccg
aaaaaggctgccgggatcgtgaagaaggtggtcgaatcggccatcgccaacgctgagcac
aacgaaggcgccgacatcgacgaactgaaggtcaaatcgatcttcgtcgacaaggcaacc
tcgctcaagcgcttcaccgcacgggcgaagggccgcggcaaccgcatcgagaaacaaacc
tgtcacatcactgtgacgctcggcaactaa

DBGET integrated database retrieval system