KEGG   Cupriavidus necator N-1: CNE_2c04980Help
Entry
CNE_2c04980       CDS       T01564                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase MhpE
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00360  Phenylalanine metabolism
cnc00362  Benzoate degradation
cnc00621  Dioxin degradation
cnc00622  Xylene degradation
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc01220  Degradation of aromatic compounds
Module
cnc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
cnc_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CNE_2c04980 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_2c04980 (mhpE)
   00622 Xylene degradation
    CNE_2c04980 (mhpE)
   00621 Dioxin degradation
    CNE_2c04980 (mhpE)
Enzymes [BR:cnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     CNE_2c04980 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AEI79479
UniProt: F8GQT8
Position
2:529863..530927
Genome map
AA seq 354 aa AA seqDB search
MTAQPTRKLYISDVTLRDGSHAIRHQYSLDHVRRIAAALDAARVDSIEVAHGDGLSGSSF
NYGFGAHTDLEWIAAVAETVRHARVATLLLPGVGTVHDLRAAYDAGARVVRVATHCTEAD
VSRQHIEYARELGMDTVGFLMMSHMTTPAALAQQAKLMESYGAQCVYVVDSGGALGMQDV
RERFRAFKDVLKPETQTGMHAHHNLSLGVANSIVAAEEGCDRVDASLAGMGAGAGNAPLE
VFIAAAERLGWQHGCDLYTLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHAEA
AAARYGLGTVDILVELGRRRMVGGQEDMIVDVALDLLARRSAQAEQGVSSAAVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaacctaccaggaagctctacatctccgacgtgacgctgcgcgacggcagc
cacgccatccgccaccagtacagcctggaccacgtacgccgcatcgcggccgcgctcgac
gccgcgcgcgtggattcgatcgaggtcgcgcacggcgacgggctgtcgggctccagcttc
aactatggctttggcgcccataccgacctggaatggatcgccgccgtggccgagaccgtg
cgccatgcccgcgtggccacgctgctgctgccgggcgtgggcaccgtgcacgacctgcgc
gccgcctatgatgccggcgcgcgcgtggtgcgcgtggccacgcactgcaccgaagccgat
gtctcgcgccagcacatcgaatatgcgcgcgaactcggcatggacaccgttggcttcctg
atgatgagccacatgaccacgcccgcggcgctggcgcagcaggcgaagctgatggaaagc
tacggcgcccagtgcgtctatgtggtcgattccggcggcgcgctgggcatgcaggacgtg
cgcgagcgcttccgcgccttcaaggacgtgctcaagccagaaacccagaccggcatgcac
gcccatcacaacctgagcctgggcgtggccaattccatcgtcgcggcggaagagggctgt
gaccgcgtcgacgccagcctggccggcatgggtgccggtgccggcaacgccccgctggaa
gtctttatcgccgccgccgaacgcctgggctggcagcacggctgcgacctctacacgctg
atggatgccgccgacgacatcgtgcgcccgctgcaggaccgcccggtgcgcgttgaccgc
gagaccctggcgctgggctacgcgggggtctattccagcttcctgcgccatgccgaggcc
gccgcggcgcgctacggcctgggcacggtcgacatcctggtcgagctgggccggcggcgc
atggtgggcgggcaggaagacatgatcgtggatgtggcgctggacttgctggcgcggcgc
agtgcgcaggcggagcagggtgtgtcgtcggcggcggtggcctga

DBGET integrated database retrieval system