KEGG   Cupriavidus necator N-1: CNE_2c06060Help
Entry
CNE_2c06060       CDS       T01564                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase EchA
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00071  Fatty acid degradation
cnc00280  Valine, leucine and isoleucine degradation
cnc00281  Geraniol degradation
cnc00310  Lysine degradation
cnc00360  Phenylalanine metabolism
cnc00362  Benzoate degradation
cnc00380  Tryptophan metabolism
cnc00410  beta-Alanine metabolism
cnc00627  Aminobenzoate degradation
cnc00640  Propanoate metabolism
cnc00650  Butanoate metabolism
cnc00903  Limonene and pinene degradation
cnc00930  Caprolactam degradation
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01212  Fatty acid metabolism
Module
cnc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNE_2c06060 (echA1)
   00650 Butanoate metabolism
    CNE_2c06060 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_2c06060 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_2c06060 (echA1)
   00310 Lysine degradation
    CNE_2c06060 (echA1)
   00360 Phenylalanine metabolism
    CNE_2c06060 (echA1)
   00380 Tryptophan metabolism
    CNE_2c06060 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_2c06060 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_2c06060 (echA1)
   00281 Geraniol degradation
    CNE_2c06060 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_2c06060 (echA1)
   00627 Aminobenzoate degradation
    CNE_2c06060 (echA1)
   00930 Caprolactam degradation
    CNE_2c06060 (echA1)
Enzymes [BR:cnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNE_2c06060 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF5320 STAS
Motif
Other DBs
NCBI-ProteinID: AEI79585
UniProt: F8GRC5
Position
2:640423..641214
Genome map
AA seq 263 aa AA seqDB search
MQTNKKTGPFRIDTADGIAELVIDHAPVNALDSAGWHALAAAIDQLGTDPAVRVIVLRGE
GRGFCAGVDIKELAAHPQRIVDVNAGNYATFRAVHRNPKPVIVAVHGFVLGGGIGICGAA
DIIVAADCARFGVPEIDRGAMGGGAHLQRMFGVQKVRAMYFTGEMIDAAEAYRLGAVERV
VPRSELRDAAMTLARQIAAKSPAMLQLAKEALNGVEDGNLEDKYRWEQGFTLQAYMSADS
GEARAAFVEGREARFAQGERDAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgaacaaaaagaccgggccgttccgcatcgacaccgccgacggcatcgccgaa
ctggtgatcgaccatgcgcccgtcaatgcgctcgacagcgccggctggcatgcgctggcc
gccgcgatcgaccaactcggcaccgatcccgccgtgcgcgtgatcgtgctgcgcggcgaa
ggccgcggcttctgcgccggcgtcgacatcaaggagctggccgcgcacccgcagcgcatc
gtcgatgtcaacgccggcaactacgccaccttccgcgccgtgcaccgcaatcccaagccg
gtcatcgtggccgtgcacggcttcgtgctgggcggcggcatcggcatctgcggcgcggcc
gacatcatcgtggccgcggattgcgcgcgctttggcgtgccggagatcgaccgcggtgcc
atgggtggcggcgcccacctgcagcgcatgttcggcgtgcagaaggtcagggcgatgtac
ttcacgggcgagatgatcgatgccgccgaggcgtaccggctgggcgcggtcgagcgcgtg
gtgccgcgcagcgagttgcgcgacgccgccatgacgctggcccgccagatcgccgccaag
agcccggccatgctgcagctggccaaggaagcgctcaatggcgtggaagacggcaacctg
gaggacaagtaccgctgggaacagggtttcacgctgcaggcctatatgagcgccgattcc
ggcgaggcgcgtgccgccttcgtcgaaggccgcgaagcccgctttgcgcagggggagcgc
gatgcagcttga

DBGET integrated database retrieval system