KEGG   Cupriavidus necator N-1: CNE_2c13890Help
Entry
CNE_2c13890       CDS       T01564                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase GtaB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00040  Pentose and glucuronate interconversions
cnc00052  Galactose metabolism
cnc00500  Starch and sucrose metabolism
cnc00520  Amino sugar and nucleotide sugar metabolism
cnc01100  Metabolic pathways
cnc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CNE_2c13890 (gtaB)
   00052 Galactose metabolism
    CNE_2c13890 (gtaB)
   00500 Starch and sucrose metabolism
    CNE_2c13890 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CNE_2c13890 (gtaB)
Enzymes [BR:cnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CNE_2c13890 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEI80352
UniProt: F8GNH7
Position
2:1483423..1484319
Genome map
AA seq 298 aa AA seqDB search
MDNRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGR
SKRAIEDHFDKAYELEVELEAKNKQALLDAVRSIKPANVECFYVRQPEALGLGHAVLCAA
KLVGDAPFAIMLADDLIDGNPPVMKQMVDIYNHYNCSVLGVEEIAPEQSRSYGVVDGREW
DEGVIKMSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRQLKPGAGGEFQLTDAIQSLL
GQEQVLAYRYQGRRYDCGNKLGYLKATVEYALKHPEVGPDFRRYLGQGDHHQADSVVA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccgagttaccaaggccgtcttccccgtcgcgggactgggcacccgcttcctc
cccgccaccaaggcgagccccaaggaaatgctgcctgtcgtcgacaagccactgatccag
tacgccgtggaagaagccatggccgccggcattaccgagatgatctttgtcacgggccgc
tccaagcgcgccatcgaggaccatttcgacaaggcctacgaactggaagtggagctcgag
gccaagaacaagcaggcgctgctggacgcggtccgttctatcaagccggccaacgtcgag
tgcttctatgtgcgccagcccgaagcactgggcctgggccacgccgtgctgtgcgcagcc
aaacttgtcggcgacgcgccttttgccatcatgctggccgatgacctgatcgacggcaat
ccgccggtgatgaagcagatggtcgacatctacaaccactacaactgctcggtgctgggc
gtggaagagatcgcgccggagcagagccgctcctatggcgtagtcgacggacgcgaatgg
gacgagggcgtcatcaagatgtccggcatcgtggaaaagcccgcgccggaagatgctccc
tccaacctgggcgtggtcggccgctatatcctgacgccgcgcatcttcgaccacctgcgg
cagctcaagccgggcgccggaggcgagttccagctcaccgacgccatccagtcactgctc
ggccaggagcaggtgctggcctaccgttaccagggcaggcgctacgactgcggcaacaag
cttggctacttgaaggccactgtcgagtacgcgctgaagcacccggaagtcggccccgac
ttccgccgctacctggggcagggtgaccatcatcaggctgacagcgtggttgcctga

DBGET integrated database retrieval system