KEGG   Cupriavidus necator N-1: CNE_2c16210Help
Entry
CNE_2c16210       CDS       T01564                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00780  Biotin metabolism
cnc01100  Metabolic pathways
Module
cnc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CNE_2c16210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cnc01007]
    CNE_2c16210
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CNE_2c16210
Amino acid related enzymes [BR:cnc01007]
 Aminotransferase (transaminase)
  Class II
   CNE_2c16210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEI80577
UniProt: F8GPU0
Position
2:complement(1749734..1750855)
Genome map
AA seq 373 aa AA seqDB search
MIDFASALYLGMTHPAARLGDYAALTSGVPASLAASPQARGVAARAAELQGCEAGAVAPS
TLHLAIDTFDRLARSHVLIADEALYPVMRWSLERVSGLGASLSWFAHGDPAALVRVLRRS
RAGKPPAVITDATLRNGMPIAPQGYLEAVASRDGLLVIDHSQVLGLLGEHPIPKQPWGLG
GGGIAVHGGLGPSDPVLLLASWAKAFGVPLATLCGPAALVSDIACNGPTQSHCSAANQAA
LLAALDALDANRRTGDWLRTRLLYFVRRLRAGLLSLARTVLPDLSATLPLHPMQRIHLST
PGRTQALHASLRACGFRTALLHDAENRHAVVAIVRADHRLSDIDGLVQTMAATAPALPAS
DETLSKSMGRHHV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactttgcctcggcgttataccttggcatgacgcatccggccgcgcgcctcggc
gactatgccgcattgacgagcggtgtgcccgcatcgctcgcggcatcgccgcaggcgcgt
ggcgttgccgcgcgcgcagccgagttgcagggttgcgaggccggtgcggtggcgccgtcc
acgctgcatctggcgatcgataccttcgaccgcctcgcgcgcagccacgtgttgattgcc
gacgaagcgctatatccggtcatgcgctggagcctcgagcgcgtaagtggcttgggcgca
tcgctgtcgtggttcgcgcatggcgatcctgccgcactggtacgcgtattgcgccgtagc
agggcgggcaagccgccggcagtcatcacagacgccacactgcggaacggcatgccgatc
gcgccgcagggatatctggaagccgtcgcttcacgcgatggcttgctcgtgatcgaccat
agtcaggtccttgggctcctcggtgagcatcccataccaaagcagccgtgggggctgggt
ggtggtggcatcgccgtgcacggcggcctggggccatcggacccggtcctgctgttggcg
tcatgggccaaggcattcggcgtgccgctggccacgctgtgcgggcccgccgcgttggtc
agtgacattgcgtgcaatggtcccacgcagtcgcattgcagcgctgctaaccaggccgcg
ctgttggcggcgctcgatgcactagacgccaatcggcgcaccggagactggctgcgtacg
cgcctgctctacttcgtgcggcggctgcgtgcgggcctgctgtcgctggctcgtaccgtg
ctgccagatctgtccgcaacgctgccactgcatccgatgcaacgtattcatctgagtacg
ccggggcgaacacaggcgctgcatgcctcgctgcgtgcgtgtgggtttcgtaccgcgtta
ttgcacgatgccgagaaccgccatgcggtggtcgcgatcgtgcgtgccgatcatcggctg
tccgatatcgacggactggtgcagacgatggcagcgacggcgcctgcgctgcccgcgtcc
gacgaaacgctatccaagtccatggggaggcatcatgtttaa

DBGET integrated database retrieval system