KEGG   Cupriavidus necator N-1: CNE_BB1p04870
Entry
CNE_BB1p04870     CDS       T01564                                 

Gene name
trbJ
Definition
(GenBank) conjugal transfer TrbJ signal peptide protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CNE_BB1p04870 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cnc02044]
    CNE_BB1p04870 (trbJ)
Secretion system [BR:cnc02044]
 Type IV secretion system
  Trb secretion system protein
   CNE_BB1p04870 (trbJ)
SSDB
Motif
Pfam: N_NLPC_P60 UCH
Other DBs
NCBI-ProteinID: AEI81911
UniProt: F8GX41
Position
BB1p:complement(502160..503248)
AA seq 362 aa
MKARVLSVSLAAALSVSLLAVQPASALTVFDPSNFVQNTLTAVRTLEQINNQINQLQNEA
QMLLNQARNLTKLDFNITNRLRSTLATTERLIAEAQGLAYDVQSMDATFSRLYPEQYAAT
ISGDRMAQDARERWKNTLDGLHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAMQ
ATNQLLALQAKQSIQTQQLQITQDRAASLELARQAAATERAREVRRRFLGTGTSYTPQSV
NFYNNRREAAMRGVPVLSVSLLAVLLTACGQQPAEDLAATLAADPVRLKVLRARCVADRQ
AAGKDTCRAAAEAFRRRFFAGQAGPDEYRTLAELPPIPASFDTPDDHAPEGDAPLAAAED
TP
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaaagcccgtgtcctttccgtttcgctcgccgccgcgctgtcggtgtccctgctggcc
gtgcagcctgcatcggcgctgacggtgttcgacccatccaacttcgtgcagaacacgctc
accgccgttcgcacgctggagcagatcaacaaccagatcaaccagctccaaaacgaagca
cagatgctgctgaaccaggcgcgcaacctgacgaagctggatttcaacatcaccaaccgc
ctgcgctcgacgcttgccaccaccgaacgcctgatcgccgaagcgcaggggttggcctac
gacgtgcagagtatggatgccacgttctcgcgcctgtacccggagcagtacgccgccacc
atcagcggcgaccgcatggcacaggacgcacgcgaacgctggaagaacacgctcgacggc
ctgcacaccgcgatgcggatgcaggcgcaggtgtcgcagaacctggcgcaagacgaaagc
gcgctagccgacctcgtgagccagagccagtcggccaccggcgcgctgcaagcgatgcag
gcaacgaaccagcttctcgccttgcaggccaagcagtccattcagacccagcagctccag
atcacgcaagaccgggcggcctcgctggaactggctcggcaggcggcggccaccgagcgc
gcccgcgaagtgcggcggcgcttcctgggcaccggcacgtcgtacacgccgcagtccgtc
aacttctacaacaaccgacgggaggcggccatgcgaggcgttcccgttctgtccgtttcg
ctgctggccgtgctgctgaccgcgtgcggccagcagccggccgaagacctggccgccacc
ttggccgccgatcccgtgcggctcaaggtgctgcgcgcccgatgcgtagccgaccggcaa
gccgcaggcaaagacacctgccgggccgccgccgaagccttccggcggcggttcttcgcc
ggccaggccgggccggacgaataccggacgctggccgaactgccgccgattccagcgagc
ttcgacacgcccgacgaccacgcgccggaaggcgatgcgccgctcgccgctgcggaggac
acgccatga

DBGET integrated database retrieval system