KEGG   Cupriavidus necator N-1: CNE_BB1p05180Help
Entry
CNE_BB1p05180     CDS       T01564                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00071  Fatty acid degradation
cnc00072  Synthesis and degradation of ketone bodies
cnc00280  Valine, leucine and isoleucine degradation
cnc00310  Lysine degradation
cnc00362  Benzoate degradation
cnc00380  Tryptophan metabolism
cnc00620  Pyruvate metabolism
cnc00630  Glyoxylate and dicarboxylate metabolism
cnc00640  Propanoate metabolism
cnc00650  Butanoate metabolism
cnc00900  Terpenoid backbone biosynthesis
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
cnc01212  Fatty acid metabolism
cnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_BB1p05180
   00630 Glyoxylate and dicarboxylate metabolism
    CNE_BB1p05180
   00640 Propanoate metabolism
    CNE_BB1p05180
   00650 Butanoate metabolism
    CNE_BB1p05180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CNE_BB1p05180
   00072 Synthesis and degradation of ketone bodies
    CNE_BB1p05180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_BB1p05180
   00310 Lysine degradation
    CNE_BB1p05180
   00380 Tryptophan metabolism
    CNE_BB1p05180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CNE_BB1p05180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_BB1p05180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CNE_BB1p05180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cnc04147]
    CNE_BB1p05180
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CNE_BB1p05180
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNE_BB1p05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEI81938
UniProt: F8GX68
Position
BB1p:533634..534809
Genome map
AA seq 391 aa AA seqDB search
MSMSNRVAIVSMAQVNYSEKRAYSPEELAYQAIRPVLQETGLRFLPAYEKGGIDASLICH
EHSRIARPFSASLVVDVAGANLRPDEKIDQDGAVGVLEAAWQIASGEFETVLVVAVCHDS
TSNSAANAIENKVFDPFFCRPLGLDNVQAAGLQANRYMEKYGITPGQCAAVSVKNLRHAK
DNAWALRAGDYSVADVLGSKALSDPITALQTRAFGDSAIVMLLASEERARQLTSKPVWIK
GQANCCDGYNLGDRDLADSEVLKIAANKAYRMAGISDPRKEIDLLEVTDEFSYQELMAYE
GLGLCEAGQGGRWLESGTSSRGGHQPVNLSGGALSGCSHTTIGMGRIAEIVLQLRGEAGA
RQVDGARTGLAHLASGPCGQLQQVMVLGTTP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgtcaaaccgtgtcgccatcgtctccatggcgcaagtcaactacagcgagaag
cgcgcgtactcgcccgaggaactggcctaccaagccatccgtcccgtgctgcaggagacc
gggctgcgcttcctgccggcctacgagaagggcgggattgatgccagcctgatctgtcac
gagcactcgcgcatcgcgcggccgttctcggcatcgctggtggtcgacgttgccggtgcc
aacctgcgtcccgatgaaaagatcgatcaggacggcgccgtcggcgtgctcgaagcggcc
tggcagattgcctccggcgagtttgagacggtgctggtggtagccgtgtgccacgactcc
accagcaacagcgcggccaatgcgatcgagaacaaggtcttcgacccgttcttctgccga
ccgcttggcctcgacaacgtgcaggccgccgggctgcaggccaaccgctacatggagaag
tacggcatcacacccgggcaatgcgcggcggtgtcggtgaagaacctgcgccatgccaag
gacaacgcatgggcgctgcgcgcgggggactatagcgtcgccgacgtgctcggctcgaag
gcactgtcagatccgatcacggcgctgcagacgcgtgcgttcggcgacagcgccatcgtc
atgctgctggccagcgaggaaagggcgcggcagctgaccagcaagccggtgtggatcaag
ggccaggccaactgctgcgacggctacaacctgggggaccgcgaccttgcggactcggag
gtgctgaagatcgcggcgaacaaggcctatcgcatggccggcatcagcgatccgcgcaag
gagatcgatctgctcgaggtgacagatgaattctcctaccaggagctgatggcctatgag
gggttgggcctgtgcgaagccgggcagggcggccgttggctggagtcgggcacgagcagc
cgcggcgggcatcagccggtcaacctgtccggcggcgcgctgtctggttgctcccatacc
accatcggcatgggccgcattgccgagattgtgctgcagctacgcggcgaggcgggcgcg
cgccaggtggacggcgcccgcaccgggcttgcccatctggcttcggggccgtgcgggcaa
ctgcagcaggtcatggtcctgggcaccacgccttga

DBGET integrated database retrieval system