KEGG   Cupriavidus necator N-1: CNE_BB1p09210Help
Entry
CNE_BB1p09210     CDS       T01564                                 

Gene name
aldX
Definition
(GenBank) aldehyde dehydrogenase AldX
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00053  Ascorbate and aldarate metabolism
cnc00071  Fatty acid degradation
cnc00280  Valine, leucine and isoleucine degradation
cnc00310  Lysine degradation
cnc00330  Arginine and proline metabolism
cnc00340  Histidine metabolism
cnc00380  Tryptophan metabolism
cnc00410  beta-Alanine metabolism
cnc00561  Glycerolipid metabolism
cnc00620  Pyruvate metabolism
cnc00625  Chloroalkane and chloroalkene degradation
cnc00903  Limonene and pinene degradation
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_BB1p09210 (aldX)
   00053 Ascorbate and aldarate metabolism
    CNE_BB1p09210 (aldX)
   00620 Pyruvate metabolism
    CNE_BB1p09210 (aldX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CNE_BB1p09210 (aldX)
   00561 Glycerolipid metabolism
    CNE_BB1p09210 (aldX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_BB1p09210 (aldX)
   00310 Lysine degradation
    CNE_BB1p09210 (aldX)
   00330 Arginine and proline metabolism
    CNE_BB1p09210 (aldX)
   00340 Histidine metabolism
    CNE_BB1p09210 (aldX)
   00380 Tryptophan metabolism
    CNE_BB1p09210 (aldX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNE_BB1p09210 (aldX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CNE_BB1p09210 (aldX)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CNE_BB1p09210 (aldX)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CNE_BB1p09210 (aldX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pox_TAA1
Motif
Other DBs
NCBI-ProteinID: AEI82333
UniProt: F8GUC9
Position
BB1p:964064..965419
Genome map
AA seq 451 aa AA seqDB search
MDYHRQHAEQSQAIRRVFDLQNHHQWNVRARTASQRAASLLRLKECIRRREPEIRFALFQ
DLRKPIDGPSEFSFLHEIDTTVAQLAQWMQDIELDPLPEFGTAKSFITYEPKGVVLLFGP
WNFPFALVFQPLVAIIAAGNCAIVKPNEMAPATSRITAQIIREVFPENEVAVFEGNVELA
NALLELPFDHIFFTGSPKVGRAVMVAAASHLASVTLELGGKNPAVVDGTVDLREAAKRIA
LARSKNAGQICLCPDYVFVPESLQSDFITHLKSAIQSTFYANGTIDKEAYEKIIDDRNFA
RLEGYLRDAVARGARIELGGEADPNDRTFHPTILTHVAPESAILQEETFGPILPVLTYKH
PEEVIEFIRARGKPLALYVFSNDRSFIEHIVQNTSSGGVTVNDCFSHCRDVRLPFGGVNT
SGIGRYHGIHGFKELSHERAIFKTHCGKALE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaccgacaacatgccgaacagagccaggctatccgtcgcgttttcgatctg
caaaatcatcaccagtggaacgttagagcgagaaccgcctcgcagcgggcagcgagctta
ttgcggctaaaagaatgtatccgtcgacgagagccggagattcgcttcgcactgttccaa
gacttgcgcaagccgatagatgggccttccgagttcagctttcttcatgagatcgatact
accgttgcgcagttggcgcaatggatgcaagacatcgaactcgaccccctgccggagttc
ggcacagcgaaatccttcatcacatatgagcccaaaggggtggtccttctgttcggcccg
tggaatttcccgttcgcgctggtcttccagcctttggtagccatcattgctgcgggcaac
tgcgctatcgtaaagccaaacgagatggcaccagccactagcaggatcaccgcacagatc
atccgagaggtgtttcccgagaacgaggtggcggtattcgaaggtaatgttgagctggcg
aacgcgctgctggaactcccgttcgatcatatcttctttaccggcagtccaaaggtaggt
cgcgcggtaatggtggccgcagctagtcacttggcctccgttacgctcgagcttggtggc
aagaatcctgctgtcgtagacggcaccgtcgatctgcgcgaggcagccaagcgtatcgcc
ctggcgcgcagcaagaatgccggccaaatctgcctttgccctgactatgtctttgtgccg
gaatcgttgcaaagcgacttcatcacgcatttgaaatcagcgatccaaagcaccttctat
gccaatggaacaatcgacaaggaggcatacgagaagatcattgatgatcgcaatttcgct
cgcctcgagggctatttgcgcgacgcggtagcccgcggtgcgagaatcgaactcggtggc
gaagctgatccgaacgacaggacattccatccgacgattctgacgcatgtcgcaccagag
tcggccattctgcaggaggagaccttcggcccgatcctgcccgtcctgacttacaagcat
cccgaagaggtgatcgagttcatccgcgctcgcggtaagcccctagcactttacgtcttc
agtaatgaccgctcttttatcgaacatattgtgcagaacacctcgtccgggggcgttacc
gtaaacgactgcttttctcactgccgagatgtgcggctgccgttcggaggggtaaataca
agtggaatcggacggtaccacggcattcatggctttaaggaactctcgcacgagcgcgct
atattcaagacgcattgcggaaaagcgctcgagtaa

DBGET integrated database retrieval system