KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA01070
Entry
CNA01070          CDS       T00243                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00100  Steroid biosynthesis
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
Module
cne_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CNA01070
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CNA01070
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 3253747
NCBI-ProteinID: XP_566548
UniProt: Q5KPZ0
Position
1:complement(join(292138..292143,292223..292261,292382..292520,292581..292606,292678..292751,292850..293090,293146..293361,293436..293653,293715..294135))
AA seq 459 aa
MDAQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGPCGTGAITLFTPLFTYF
FFFACNDAVGCTPTSVQGWKDAFALVGNYPSSAGRLWDWKAAGVYLGWYAFCMICEVVLP
GQRVEGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPRGIQAFTWLHDHFVPLISASL
AMATFQAVWVYVWSFFSGELLALGGNSGNVVYDFFIGRPLNPTIPGFPSFDLKTFNEVRP
GMILWFLLNISCACEQYVRIGKLTDSMWIVLVFEGWYVLDCLLQEHTILNQMDITTDGFG
FMLAFGDLTWVPFTYGLQARFLASTPVELGPVATALIVGVEVAGMYIFRVANNEKADFRA
GKNPKNLEYMQTERGTKLLTSGWWGRSQHPNYFGDWLIALGWCLPTGFNTPLTYFYLVYF
VILLLHRQKRDEEACKLKYGKDWDRYCEKVPYKIIPYVY
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggacgcccaggaagaatccacgacgacagtcataacagctacaacccacctcgacctc
cccgcacacccacacatcaagacctaccaagagctcaacccccgctcaaagcccacagag
ttcttcgggccatgcggcacaggcgcaatcaccctcttcacgcctctcttcacctacttt
ttcttctttgcctgcaacgatgcagtcggatgcacaccaactagtgtacaggggtggaaa
gatgcctttgcgctggtaggcaactacccgagctcggcaggtaggttgtgggactggaaa
gctgcgggcgtgtatctcggctggtatgcgttctgcatgatctgtgaagtcgtcctgccc
gggcagagagtcgaaggtaatctgttgagggatggacgacgaaaagtctacaggatgaac
ggtctttacactcttctcctcgcccttggtcttcttaccggtgtcttggtccagcccagg
ggtatccaagctttcacttggctccacgaccactttgtgcccctcatctcggccagtctg
gctatggccactttccaagccgtctgggtttatgtgtggagctttttctctggtgagctc
ttggctctcggtgggaactctggcaatgttgtctacgacttctttatcggccgacctctc
aaccctaccatccccggattcccctctttcgacctcaagacattcaacgaagttcgaccc
ggcatgatcctctggttcttactcaacatttcttgcgcttgcgagcaatacgtcaggatc
ggaaaactgactgatagtatgtggatcgtcctcgtctttgagggctggtatgtcctcgac
tgtcttttgcaagagcacacaatcctcaaccagatggacattacaaccgacggcttcggc
tttatgctcgcctttggcgacctcacctgggttccttttacctatggcctccaagcgcga
ttcttggcttccacccccgtcgagctgggtcccgtggcgacagccttgattgtcggtgtc
gaagtcgcggggatgtacatcttcagagtagctaataatgaaaaggccgacttcagggct
ggaaagaaccccaagaacttggaatacatgcagacggagagagggaccaagcttttgact
tctggctggtggggccgatctcagcaccctaactactttggcgactggctcattgctctc
ggatggtgtctccccaccggcttcaacacccctctcacatacttttacctcgtctacttt
gttatccttcttttgcacagacaaaagagggacgaagaggcatgtaaactcaaatatggc
aaagactgggaccgttattgtgaaaaagtgccttacaagattatcccttacgtctattaa

DBGET integrated database retrieval system