KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA02940Help
Entry
CNA02940          CDS       T00243                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00280  Valine, leucine and isoleucine degradation
cne00410  beta-Alanine metabolism
cne00640  Propanoate metabolism
cne01100  Metabolic pathways
cne01200  Carbon metabolism
Module
cne_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNA02940
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNA02940
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNA02940
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CNA02940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Disulph_isomer
Motif
Other DBs
NCBI-GeneID: 3253433
NCBI-ProteinID: XP_566708
UniProt: Q5KPF9
Position
1:complement(join(773254..774169,774220..774412,774459..774584,774639..774720,774793..774906,774978..775097))
Genome map
AA seq 516 aa AA seqDB search
MSSTARIQLLQRMSRPTATSRLAVLNRHLSSSAQMAAPREELVLFESQQDTRIYKLNRSA
KLNSLNLEMIDSLSSKIKAWRELDSCKVIIGTGDSRAFCAGGDVKQLVLDLKEGKQTAVP
FFKSEFQLNWLLARLGKPYVAVIDGVTMGGGGGLSLPAHIRIATPRTIFAMPETKIGYSP
DVGSNYYFAQLDGFIGAWLAVTGQEVYGRAAYELGIATHYVTENNISDIVYQITQHPSPT
PANISSLISAYTAPASATSEASSKSSPDGHTPIKGEIRKFLDKTFNKKSIQEIYAALDKS
QSDDKLSSEVKEWAAHQKLQMEARSPTGMAVALQNYRKAREIRRLDRTLLNDISMATAYS
GTNRATDDFITGVSAVLIDRSKGPVAWAPKDINEESLSPQNINSRFFSASSPHVADKPEI
EFTPSSASKLDSGRDSTWGQFRKYGLPSEEAVRAAVDGYAPGSGAFALLEEELIEQFVDA
QGDVGGTRRDEVIKRVKEVVNACCKKGKDGYLEWTA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacagctcgcatacagctcctacagcgtatgtctcgcccaacggccacctct
aggctcgcagtactcaacagacatctctcttcatctgcgcagatggccgccccgcgtgag
gaactcgtgcttttcgagtctcagcaagacactaggatatacaagctcaatcgatctgcc
aagctgaattccctcaaccttgagatgatcgattctctctcaagtaaaatcaaggcttgg
cgggaacttgattcttgtaaagtcatcatcggaactggcgatagtcgggcattttgcgcc
ggtggagacgtaaagcaactcgtcctcgaccttaaggagggcaagcaaacagcggttcca
tttttcaaaagtgaatttcagctcaactggttgctcgcaagattgggaaaaccttatgtc
gctgtcattgacggtgttactatgggtggcggcggcggtctttctctccctgcgcacatc
agaatagctactccccgcaccatcttcgccatgcctgagaccaagattggctattcccct
gacgtcggttccaactactatttcgctcaactcgatgggttcatcggcgcttggctagcg
gtgaccggccaggaggtgtacggtcgtgcagcctatgaacttggtattgctacgcactat
gtgaccgaaaacaacatctcggatatcgtctaccagatcactcagcacccttcccccact
cctgcgaacatttcctctttgatttccgcctataccgcgcccgcttctgctaccagcgaa
gcctcatcgaaatcttcccctgacgggcatactcccatcaagggcgagattcgcaagttc
cttgacaaaacttttaataagaagagtattcaagagatttacgctgccctagacaaatca
caatcagacgataaactttcttctgaggtcaaggaatgggctgcccatcagaagcttcaa
atggaagctcgctccccgacgggtatggctgttgcccttcaaaactatcgcaaggcccga
gagatccgtcgtcttgaccgaacgttgttgaacgacatatcaatggccactgcttactcc
ggaaccaaccgtgcgacagatgacttcatcactggtgtttcggcggtgcttattgatcgc
tccaaaggcccagttgcgtgggcacctaaggacatcaacgaagagtctttgtcccctcag
aatattaactcaagattcttttctgcatcatcacctcacgtcgctgacaaacccgaaatt
gaattcactccctcttccgcgagcaagctcgattctggtagagactctacctggggccag
ttccgaaaatatggtcttccatctgaagaggctgtgcgggcagcagttgatggatatgcc
cctggctccggcgcatttgcgcttttagaggaagagttgatcgagcaatttgtggatgcc
cagggcgacgtaggagggactaggagggatgaggttataaagcgggtcaaagaagttgtg
aatgcttgttgcaagaagggaaaggatggatacctcgaatggactgcttaa

DBGET integrated database retrieval system