KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA03330Help
Entry
CNA03330          CDS       T00243                                 

Definition
(RefSeq) ubiquitin-carboxy extension protein fusion
  KO
K02927  large subunit ribosomal protein L40e
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03010  Ribosome
Module
cne_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CNA03330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cne03011]
    CNA03330
Ribosome [BR:cne03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CNA03330
  Archaea
    CNA03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2407 Telomere_Sde2 Fer2_3
Motif
Other DBs
NCBI-GeneID: 3254022
NCBI-ProteinID: XP_566660
UniProt: P40909
Position
1:join(869124..869143,869221..869378,869588..869679,869735..869794,869853..869912)
Genome map
AA seq 129 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYARLPPRATNCRKRKCGHSSQ
IRPKKALKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtcaagactcttaccggaaagaccatcaccctcgaggtcgagtcctcc
gacaccatcgacaatgtcaagtccaagatccaggacaaggagggtatcccccctgaccag
cagcgattgatcttcgccggaaagcagcttgaggatggcaggaccctttctgactacaac
atccagaaggagtctaccctccatcttgtcctccgtctccgaggtggtatcatcgagccc
tctctcaaggctcttgcttctaagtacaactgtgagaagcaaatctgccgaaagtgctac
gcccgtctccctccccgtgccaccaactgccgaaagaggaagtgtggccactcttctcag
atccgacccaagaaggccctcaagaagtaa

DBGET integrated database retrieval system