KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA03720
Entry
CNA03720          CDS       T00243                                 

Definition
(RefSeq) calcium transporting ATPase, putative
  KO
K14802  phospholipid-transporting ATPase [EC:7.6.2.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cne03009]
    CNA03720
Enzymes [BR:cne01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     CNA03720
Ribosome biogenesis [BR:cne03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    CNA03720
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 3253992
NCBI-ProteinID: XP_566703
UniProt: Q5KP96
Position
1:join(998182..998396,998461..998990,999043..999084,999134..999243,999291..999496,999552..999842,999887..1000062,1000109..1000172,1000224..1000550,1000600..1000729,1000784..1001005,1001061..1001309,1001357..1001440,1001501..1001615,1001663..1001736,1001789..1001801,1001856..1002001,1002052..1002166,1002217..1002260,1002315..1002548,1002601..1002743,1002796..1002821,1002869..1003052,1003102..1003191,1003235..1003385)
AA seq 1326 aa
MPAQQQDPFDDLLGSDSPPAPPRNDIFHEGRHIDFFHQGSSTARAPAAISQRGSSPDSVN
QATYALDPFFDDDDEYGPAVSNSYSGYLAPHPSSALHSSQPLGRSDPSLLESSMPLANAG
AMPAGFSGPMDDNDVKGYQASSSTAYAAEDPFRDDEGPSAYAFTAPGASSGWTQPRRSRW
QMFRDDYLTDVDWSFGVNQLLRRRSKFDGVPREIALNEPEENRLKGFERNSVTTGKYGPI
TFLPKFLLSEFSRSANLFFLFTACIQQVPNVSPTGHWTTIVPLGVVIIASAFKEIKEDFK
RHASDRSLNNNLAQVLVDQQFQLRPWRRLRVGDIVRLEANSFIPADIVLISSSEPEGLCY
VETANLDGETNLKIKQAHPSTASLTNPHSVSLLRGHILSEPPNSSLYTYDGTFHLSSAHP
GSAPTKIPVGPNQMLLRGAQLRNTGWVYGVIVNAGHETKLMRNATEAPVKRTAVERQVNR
QILYLFLLLIVLSLVSTIGSSIRTWLFDKNAWYLRLGDESKNKARQFIEDILTFIILYNN
LIPISLIMTMEVVKFQQASLINSDLDMYYAPTDTPALCRTSSLVEELGQIAYIFSDKTGT
LTRNEMEFRECTIFGTMYAQTVDDNKRDQGQKTFDSLRHRAQEDSQEGHVIREFLSLLSI
CHTVIPEEHDGKMVYQASSPDEAALVAGAEMLGYRFQTRKPKSVFIDVNGETQEWEILNV
CEFNSSRKRMSTVVRGPDGTIKLYTKGADTVIFERLAPKQEFSEPTLVHLEDYATEGLRT
LCLAYRDISEEEYSSWSALYNNAASQMSGRAEALDKAAEVIEQNLQLLGATAVEDKLQDG
VPDAIHTLQQAGIKIWVLTGDRQETAINIGLSCRLISESMNLVIVNTETAVETSELLNKR
LFAIKNQRLGGDTEELALIIDGKSLTYALEKDCSDVFLELAIMCKAVICCRVSPLQKALV
VKLVKRSTDAPLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADIAISQFRFLRKLL
LVHGSWSYQRLTKLILYSFYKNITFALTLFWYSWFNDYSGQIAFEGWSMSYYNVVFTILP
PLVIGIFDQFVSARMLDRYPQLYHLGQQNYFFTPIRFFYWVGNAFYHSVLLFAFSVLVFY
NDLLATDGKNSGLWVWGTTLYLAVLLTVLGKAALISDVWTKYTLAAIPGSFIFTMIALPL
YAIIAPLLNFSLEYTGIVPRLWADPVFYFVLLLFPIICLLRDYVWKYYRRTYHPASYHIV
QEIQKFSLSDYRPRQEQFQKAIKKVRATQRMRRQRGFAFSQTETNNQDQARLIRAYDTSV
ARPSGY
NT seq 3981 nt   +upstreamnt  +downstreamnt
atgcccgcgcaacagcaggaccccttcgacgacctcctcggctcagattcccctccagcc
ccaccaaggaacgacatattccacgagggccggcatatcgacttttttcaccaaggcagt
agcaccgctcgtgcacctgccgcaatttcccaaagaggttcatctccggattcagtaaac
caagcaacatatgctttggatccgttctttgatgatgatgatgagtatggacccgctgta
tccaacagctattctggatatctcgctcctcatccgtcctctgcccttcacagctcccaa
cctctcggtcgttccgatccctcccttttagaatcaagtatgccccttgcaaacgcgggc
gccatgcccgcaggcttctcaggcccaatggacgataatgacgtcaaaggctatcaagct
tcctcttcgacagcttatgccgccgaggacccctttagagacgatgaaggtccatctgcc
tatgcgttcaccgctccaggtgcgtcaagcggatggacacagccgcggcgcagtagatgg
cagatgttcagagatgactacttgacggatgtagactggtcgtttggtgtaaaccagctg
ctaagaaggagaagcaagttcgatggggtgcctcgtgaaatagccttgaacgaaccggaa
gaaaatagactgaagggattcgagaggaattctgttactaccggcaagtacggtcccatc
acattcctgccaaaattcttgttgtccgagttctctcgttcagccaatttgttctttctg
ttcacagcttgtattcagcaagttcccaatgtatctccgacaggtcactggacaactatc
gttcctcttggagttgtcattatcgcaagcgcttttaaggagatcaaagaagacttcaaa
cgtcatgcgtctgaccgatccttgaacaataatctcgcccaagtgctagttgatcaacaa
tttcaattaaggccgtggcgtagactacgagtcggtgacattgtgcgattagaagctaac
agctttattcctgcggacatagtcttgataagtagcagtgagccagaaggcttgtgttac
gtcgaaactgcgaatctcgatggggaaacaaatctgaaaatcaaacaagctcatccttct
acggcttcacttacaaatcctcactccgtatctttgcttcgcggacacatcctttccgaa
cctccaaattcatctttatatacgtatgatggtaccttccacctttcttccgctcatcct
ggatctgcgcctacaaaaattcccgttggtccaaaccaaatgctgctgagaggtgcccag
ttgaggaataccggctgggtgtatggtgtgatagtcaatgcgggtcacgagacgaagctc
atgcgaaatgcgactgaggcccccgttaagcgaacggctgttgagcgtcaggttaatagg
cagattctttaccttttccttcttttaatcgtcctctcacttgtttcgaccatcggaagc
agcatcaggacgtggctatttgacaagaacgcctggtatttgcgattgggtgatgaaagc
aagaataaagctcgacagttcatcgaggacatcctgacgttcataattctgtataacaac
cttattcccatttccctcattatgacaatggaagtcgtcaaattccaacaagcatccctc
ataaactccgacctcgacatgtactacgctcccaccgacactccagctttgtgccgaaca
tcgtcacttgttgaagaactcggacaaatcgcatacattttctcagacaagactggaacg
ctgacccggaacgaaatggagtttagggaatgtaccattttcggtacgatgtatgctcag
acggtggacgacaataagagagatcaagggcaaaaaacgtttgattctctaagacataga
gctcaggaggacagtcaggaaggacatgtcatacgagaattcctatctttactttcaatt
tgccacaccgtgattccggaggagcatgatggaaaaatggtgtatcaggcttcaagtcca
gatgaggctgccttggtggcgggcgccgagatgcttggctatcgcttccaaactcgcaaa
cccaagtctgtattcattgatgtcaatggcgaaactcaagagtgggaaattctcaacgtc
tgcgaattcaactcttctcgaaagagaatgtcaactgtcgttcgtggacctgatggcacg
atcaagctgtatacaaagggtgccgacactgtgatcttcgagagactggcgccgaaacag
gaattctccgagcctacacttgtacaccttgaagattacgctacagaagggcttcgaacg
ctttgtcttgcgtatcgcgacatttccgaagaagagtactcgagctggtctgcattatac
aataatgctgcttctcagatgtcggggcgagcagaagctcttgacaaagcggctgaggtc
attgagcaaaacttgcaactcttgggggcgacggctgtcgaagataaattgcaagacggt
gttccagacgctattcacaccttacaacaggcagggatcaagatttgggtgttgactggt
gacagacaagaaactgctatcaacatcggcctttcctgtcgactcatatccgaatctatg
aatcttgtcattgtgaatactgagactgcggtcgaaacatcagagctcctgaataaacgt
ttatttgcaatcaaaaaccaacgactaggtggagacaccgaagagctcgctctgattatt
gatggcaaaagcttgacatacgcgctggagaaagactgctctgatgttttcctggagttg
gcaatcatgtgcaaggctgtcatttgttgtcgtgtatcgcctcttcaaaaggctttggtc
gtcaagctggtcaagaggagtacagatgctcctttgctcgctattggtgatggagccaac
gatgtcagtatgattcaggcggcccacgtcggtgttggcatatcaggtgtggagggcttg
caagcagcacgatctgccgatattgccatctcgcagttcagatttctacgaaaattgtta
ttggtacatggttcatggagttaccaaaggttgaccaagttgatcctctactctttctac
aagaacatcactttcgccctaactcttttctggtactcatggttcaacgattattctggt
cagattgcctttgaggggtggtctatgtcctattacaatgtcgtcttcaccatcttacct
cctctcgtaattggtatatttgatcaatttgtttccgctcgtatgctcgatcgctatcct
cagctttatcatcttggccagcaaaattacttctttacacctattcgctttttctattgg
gtcggcaatgcgttttaccacagtgttcttctctttgcgttctctgtcctggttttctac
aacgatttacttgccacagatgggaaaaattctggcttatgggtttggggcaccaccctg
tatctggcggtgttgctaactgtcttgggcaaagcggccctgatttcagatgtttggacc
aaatacactttggccgcgattcccggatctttcatttttaccatgattgctttgccgctg
tatgctatcatcgcccctcttctgaacttctcactagagtatactggcattgtaccccgt
ctctgggccgatcctgtcttctattttgttttattacttttccccatcatttgtcttctc
cgtgactatgtttggaaatactatcgacgcacataccaccctgcgtcctatcatatcgtg
caggaaattcaaaagttcagcctctcagactaccgacctcggcaagaacaatttcaaaag
gctatcaaaaaggtgcgcgccacccagcgtatgcgacgacagagaggatttgccttttca
cagaccgagaccaataaccaagatcaagcacgacttatcagggcatatgacaccagcgtg
gcgagaccttcaggatattag

DBGET integrated database retrieval system