KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA06290Help
Entry
CNA06290          CDS       T00243                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00260  Glycine, serine and threonine metabolism
cne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01230  Biosynthesis of amino acids
Module
cne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNA06290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNA06290
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CNA06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP His_biosynth
Motif
Other DBs
NCBI-GeneID: 3253761
NCBI-ProteinID: XP_566976
UniProt: Q5KNJ3
Position
1:complement(join(1707222..1707321,1707408..1707744,1707797..1708967,1709024..1709259,1709315..1709408,1709454..1709610,1709656..1709663,1709710..1709754))
Genome map
AA seq 715 aa AA seqDB search
MAEQLKQVYADKKAQDQAAFVTFLTAGFPTRDATVPLMLALEAGGADIIELGVPFSDPVA
DGPVIQKANNVAIENNVHYSDCIEYVRQARAQGLKAPVLFMGYYNPIIAYGEERAVKDAR
EAGANGYIVVDLPPTEAVDFRNTCTKAGMSYIPLVAPSTSIDRVKFLTSIADSFIYVVSK
MGVTGSSSSENISASLPELVKRIRTFTTIPLAVGFGIDNRTHFDYVTSSGADAVVVGSKI
IKLIFEHADDGLAPKVVEDYCREITLKGQNPPPLGRKNAAAPPPANGGDVSPPLPIPSGS
PLGESQVKVTAAGKLPSRFGLFGGAYVAESLVDCLNELEAAYAEAKEDPAFWKEFEDMFG
YINRPSELYLAERLTEEMGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKRRIIAET
GAGQHGVATATVCAKFGMECDIFMGAEDVRRQELNVFRIKMLGGRVIPVTAGSQTLKDAV
NEAMRDWVTRLDSTHYLIGSAIGPHPFPTIVRDFQRVIGREIKSQMHEKMGKLPDAVVAC
VGGGSNAIGTFYDFIEDPSVRLVGVEAGGHGIDTEAHSATLTKGVMGVVHGAASYIIQSK
EGQLTPTHSISAGLDYNSVGPEHSHLKYSGRAEYVVADDLQCLKAFKMCTELEGIIPALE
SSHGLWGGMQLAKSLPKDKDIVICLSGNGAKDVAEVLLTLKNKEWADKLDWHVAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagctcaagcaagtatacgcagacaaaaaggcccaggaccaggccgccttt
gtcacctttttgacagctggtttccctacccgcgatgccacagtgcccctcatgctcgcc
ctagaggcaggcggtgctgacattatcgaactcggtgtcccattcagtgacccagtcgcc
gacggtccggtcatccaaaaggccaacaacgttgccattgaaaacaatgtccactactct
gactgtatcgagtacgtccgacaggctcgtgcccaaggtctcaaggctcccgtcttgttc
atgggctactacaaccccatcatcgcttatggcgaggaaagagctgtcaaggacgctcga
gaggccggtgccaacggctacatcgtcgtcgacttgccccccaccgaagccgtcgacttt
agaaatacttgtaccaaggcgggcatgtcgtacattcccctcgtcgccccttctaccagc
atcgatcgagtcaagttcttgacttctatcgccgattctttcatctatgtcgtctccaag
atgggtgtcaccggttcctcttcttccgaaaacatctcagcctccctccccgaacttgtc
aagcgtatccgaacgttcaccacgatccccctcgctgtcggttttggtatcgacaaccgt
acccactttgactatgtcacatcttccggtgctgatgctgttgtcgttggatccaaaatc
atcaagctcatctttgagcacgccgacgacggtcttgcacccaaggtcgtcgaagactat
tgccgagaaatcacactcaagggccagaaccctccccctcttggccgaaagaatgctgct
gccccgcctcctgccaatggaggtgacgtctctccccccctccccattccctctggctca
cctctcggcgagtcccaagtcaaggtcaccgccgccggtaaactcccttctcgattcggt
cttttcggtggcgcctatgtcgccgaatcccttgtcgactgtttaaacgagctcgaagct
gcgtatgccgaggccaaggaggatcctgcgttctggaaagagtttgaggatatgtttggg
tacatcaaccgacctagtgaactttaccttgccgagaggttgaccgaggagatgggcggt
gcgaggatctggctcaagagggaagatctcaaccatactggttctcacaagattaacaat
gccgttggccaaattctcctcgccaagcgattgggtaagcgaagaattatcgccgagacg
ggtgccggtcagcacggtgtcgctaccgccaccgtctgcgccaagtttggcatggagtgt
gacattttcatgggtgctgaggatgtgaggaggcaagagctgaacgtcttcaggatcaag
atgcttggtggtcgagttatccccgttaccgccggttcccagaccttgaaggacgctgtc
aacgaggctatgagagattgggtcactcgattggactctactcattatcttatcggctcc
gctatcggtccccacccgttccccaccatcgtccgtgacttccagagggttatcggtcga
gagatcaagtctcagatgcacgaaaagatgggcaagttgcccgatgctgtcgttgcctgt
gtcggtggtggctctaatgcgatcggtactttttacgactttatcgaggatccgagtgta
agactggtcggtgtcgaagctggtggtcatggtattgacaccgaggcacactctgctacg
ctgaccaagggtgtcatgggtgtcgtccacggcgccgcttcttacattatccaatcaaag
gaaggccagctcacccccacgcactccatctctgccggtctcgactacaactctgtcggt
cccgagcactctcacctcaagtatagcggtcgagcggaatatgtcgtggcggacgatttg
cagtgtctcaaggcgttcaagatgtgtaccgaattggaaggtattattcccgctttggag
agcagtcatggtttgtggggcggtatgcagttggccaagagtttgcccaaggataaggat
atcgtcatctgtttgagtggaaacggtgccaaagacgttgcagaggtgttgttgacgttg
aagaacaaggagtgggcggacaagcttgattggcacgttgcgcagtag

DBGET integrated database retrieval system