KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA07740Help
Entry
CNA07740          CDS       T00243                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00010  Glycolysis / Gluconeogenesis
cne00620  Pyruvate metabolism
cne00640  Propanoate metabolism
cne00680  Methane metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNA07740
   00620 Pyruvate metabolism
    CNA07740
   00640 Propanoate metabolism
    CNA07740
  Energy metabolism
   00680 Methane metabolism
    CNA07740
Enzymes [BR:cne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CNA07740
Lipid biosynthesis proteins [BR:cne01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CNA07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 3253764
NCBI-ProteinID: XP_567122
UniProt: Q5KN48
Structure
PDB: 

Position
1:complement(join(2137516..2137544,2137601..2137733,2137784..2138800,2138851..2139032,2139080..2139120,2139174..2139320,2139388..2139591,2139648..2139937))
Genome map
AA seq 680 aa AA seqDB search
MGKTEVAPGVHHVHPLPDSVPESEDLFAPPPRMQGKEGRPKPHLGPNYEAYVNEWAKTVG
PNNDEWWAAKARETLDWYEDFKTVRAGGFEHGDIQWFPEGTLNAAYNCLDRHFYKNPKKT
AIIYEADEPSESREISYEELMQETCRVANVLKSYGVKKGDAVSIYLPMTWQAAAAFLACA
RIGAIHSAVFAGFSAESLRDRVNDCECKVLITTDEGRRGGKSIATKQIVDAALQQCPLVE
NVLVLRRTGNKVPMTEGRDKWWDEECAKMPAYCPCERMASEDPLFILYTSGSTGKPKGVV
HCTGGYLLGAALTLKYVFDAHPDDRFACMADIGWITGHSYIIYGPLANGITTAVFESTPV
YPTPSRYWDFVDKWKATQLYTAPTAIRLLRRMGEDHVKNHDLSSLRVLGSVGEPINPEAW
HWYNDFAGKNQCAIVDTYWMTETGSISIAPLPGAISTKPGSATFPFFGMDVDIIDPQTGQ
VLEGNDVEGVLVARKPWPSIARTVYRDHKRYLETYMKPYPGYFFFGDGAARDYDGYMWIK
GRVDDVINVSGHRLSTAEVESALILHKGVAETAVVGCADDLTGQAVYAFVTMKPEFDLKS
TKEADLSKELAIQVRKVIGPFAAPKKIYLVSDLPKTRSGKIMRRILRKIVAGEGDQLGDL
SSIADPQIVDEVKRKVTGSA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacagaagttgcacccggcgtccaccacgttcaccctctccccgactccgtc
cccgagtctgaggacctcttcgctccccctcctcgtatgcagggcaaggaaggccgcccg
aagcctcaccttggtcccaattacgaggcctacgtcaatgaatgggccaagactgttggt
cccaataatgatgagtggtgggccgcaaaggccagggagactcttgattggtatgaggac
ttcaagactgtcagggccggtggctttgagcacggagacattcagtggttccccgaaggt
accttgaacgctgcttacaactgtcttgaccgacacttctacaagaacccgaaaaagacc
gccatcatctacgaggccgacgagccctctgagtcccgtgagatttcttacgaggagctc
atgcaggagacttgccgagttgccaatgtcctcaagagctacggtgtcaagaagggtgac
gctgtgtccatctatcttcccatgacttggcaagccgctgctgcgttccttgcttgtgcc
aggatcggtgccattcactctgctgtctttgccggttttagcgccgagagtttgagggat
agagtcaatgactgtgaatgcaaggttttgatcaccaccgacgagggtcgacgaggtggt
aagagtattgctactaagcaaatcgtcgatgccgctctccagcagtgcccccttgttgag
aacgttctcgtccttcgacgaaccggcaacaaggtccccatgactgaaggtcgtgacaaa
tggtgggacgaagagtgtgccaagatgcccgcttactgcccttgcgagaggatggcttcc
gaggaccctcttttcatcctctacacctctggttccaccggtaagcccaagggtgtcgtc
cactgcaccggtggttacctcctcggcgccgcccttaccctcaagtacgtctttgacgct
cacccggatgaccgattcgcctgtatggccgatatcggatggattaccggacatagttac
attatctacggccctctcgccaacggcatcaccaccgccgtctttgaatccactcccgtc
taccccacaccatccagatactgggactttgtcgacaaatggaaggctactcagctctac
actgcgcctactgcgatccgattgttaagacgtatgggcgaggaccacgtcaagaaccac
gatctcagctctctccgagtgttgggctctgttggtgagcccatcaaccccgaggcttgg
cattggtacaatgactttgcgggcaagaaccaatgtgccattgttgatacttactggatg
accgaaactggttccatctctattgctcctctccctggagccatctccaccaagcctggt
tccgccaccttccccttcttcggtatggatgttgacatcattgaccctcaaactggtcag
gtcttggagggtaacgatgtggagggtgttctcgttgccaggaagccatggcctagtatt
gccaggaccgtctacagggaccacaagaggtaccttgagacttacatgaagccttacccc
ggctacttcttctttggtgacggtgctgcccgagactatgacggttacatgtggatcaag
ggacgagttgatgatgttatcaacgtgtctggccaccgactctccaccgccgaggttgag
tctgcccttatcctccacaagggtgtcgccgagactgccgttgttggatgcgctgatgac
cttaccggtcaggctgtgtacgctttcgttacgatgaagcccgagttcgatttaaagagt
accaaggaggcggatcttagcaaggagttggctatccaggttaggaaagttattggtcct
ttcgctgctcccaagaagatttaccttgtttccgatctccccaagacccgatcagggaaa
atcatgcgtcgaattctccgaaagattgtcgctggcgagggtgaccaactgggagatctt
tcttccattgctgacccccaaattgtcgacgaagtcaagcgaaaggttaccggctctgct
taa

DBGET integrated database retrieval system