KEGG   Cryptococcus neoformans var. neoformans JEC21: CNC03340Help
Entry
CNC03340          CDS       T00243                                 

Definition
(RefSeq) protein-histidine kinase, putative
  KO
K19691  osomolarity two-component system, sensor histidine kinase NIK1 [EC:2.7.13.3]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cne01001]
    CNC03340
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cne02022]
    CNC03340
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CNC03340
Protein kinases [BR:cne01001]
 Histidine kinases
  Other
   CNC03340
Two-component system [BR:cne02022]
 Other families
  SLN1-YPD1-SSK1/SKN7 (osmosensing)
   CNC03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAMP HATPase_c Response_reg HisKA DUF1843 HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 3256127
NCBI-ProteinID: XP_024512436
Position
3:complement(join(1060108..1060395,1060449..1060916,1060968..1061692,1061748..1062157,1062210..1062424,1062477..1062756,1062806..1062846,1062903..1063043,1063102..1063194,1063247..1063444,1063502..1063561,1063610..1063681,1063726..1064886))
Genome map
AA seq 1383 aa AA seqDB search
MSLPDAYPPVIATEGSTAFQSHILSLLSVISQHPSPDYPFPSSGDSTLQDNASVTAKKNA
TLSTFPGKKTPAEDAIERAIIALGDRVWTSERTQAHLVKDVKRDVPAQPGSDLLTPDWTP
PVPTLNDSSPDPVCPTCTRPVSSSETSSFTPQQIASFYHPFTAALSTPPPPLPEQMFFPQ
SVLAAYVSATSDSESAGDSGMSAEKELELLKAQVQDIARVCKAVATGDLTQKIIVPVKGQ
TMTELKNIINAMVDRLQTFAVEVERVSLEVGTEGKLGGQAVVPNVEGTWKVLTAVVNKLA
ANLTNQVRSIAKVTKAVAKGDLSETIDVEASGEIAELKTTVNGMVMSLRTLADEVSRVSL
EVGSQGKLGGQANVPDVEGVWKDLTVNVNRMCESLTTQVRSIGSVTTAVARGDLSKMIEI
EAEGEMAVLKNTVNSMVRQLTVFAKEVTRVALEVGTHGQLGGQAVVPGVEGVWDDLTTNV
NKMARNLTDQVREIAMVTKAVARGDLSKTVNADVQGEILDLKCTVNEMVAQLTVFAAEVT
RVSLEVGTEGKLGGQAVVPNVEGTWMVLTDNVNLMALNLTTQVRSVAEVTTAVAAGDLSK
KINVAAFGEILELKNTVNNMVDSLRSFSSEVTRVAREVGTDGRLGGQAKVPGVAGTWKDL
TDCVNIMAANLTEQVRTIAHATTAVARGDLTQKVVGVKVSGEILDLVNTINNMIDQLAIF
AAEVTRVAREVGTEGKLGVQAEVENIEGTWQEITSNVNTMASNLTSQVRAFAQISAAATD
GDFTRFITVEASGEMDSLKTKINQMVYNLRESIEKNTKARQEAEMANRSKSEFLANMSHE
IRTPMNGIIGMTVLTLESELTRQQRENLMIVSSLAGSLLTIIDDILDISKIEAGRMTMEQ
IPFSLRVAVFSVLKTLCVKAAQNKLDLIFDVDPTMPDQLIGDPLRLRQVITNLIGNAVKF
TTKGQVALSCRVKRYVTVADAVELEFCVADTGIGIKQDKLDVIFDTFAQADGSTTRKYGG
TGLGLTISKRLVNLMSGDLWVESEYGQGSRFYFTTVAEMTSVPRDQIIERLSPWSGRSVL
FIDTLGDQTGIVEMLQELGLKPIVIHSVNDVYLLQDQGLTVFDTMIVDSLKAAGELRGIE
YLRYIPIVLLAPSNKPSGPSNPSFISLPESRRRLLALPSASEQLLSPIPVKDCLEMGINT
YYTTPLSLQELSNAIVPALESHQIQPGDTVKDTILSVLLAEDNLVNQKLAVKLMEVAGHK
IEVADNGEIALEKYKRRQLARTPFDVILMDVSMPVMGGMEATGLIREFEANEGVPRTPII
ALTAHAMIGDKERCLAAGMDEYVTKPLRRGDLLASIAKVLAPKQSASGLEMPAVPIPANI
YGR
NT seq 4152 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccccgatgcctaccctccggtcatagccaccgaagggagcacggcattccaa
tcgcatattctttccctgctgtcagtgatatcccaacacccgtctcccgattatccattc
ccatcaagtggcgattctacgctgcaagacaacgcttctgtgacggcaaaaaagaatgct
accctttcaacctttcccggcaaaaagaccccggctgaggatgcgattgagcgagctatt
attgccctcggtgatcgtgtttggacttccgagaggacgcaggcgcatctggtaaaggac
gtcaaacgcgacgttcctgcccaacctggttcagatctgcttactcctgattggactcct
ccggtccccaccctcaacgactcctctcccgatcctgtttgtcctacctgcactcggccc
gtttcctccagcgaaacctcttctttcactccccagcagatcgcatctttctatcatcct
tttacggctgccctgtcaacgccgccgcctcctcttcccgaacaaatgttcttcccacag
agcgttcttgctgcttatgtctctgctacttctgacagcgaatcggctggcgattctggc
atgtctgccgaaaaggaactcgaacttctcaaagctcaagttcaggacatcgcccgtgtg
tgtaaagctgtcgccactggtgatcttactcagaagattattgtacccgttaaaggccaa
accatgactgaactcaaaaacatcatcaatgcaatggtggatcgtctgcaaacttttgcc
gtggaagtcgagcgcgtgtctttggaagtcggtactgaaggaaaacttggtggacaggcc
gtcgtacccaatgtcgaaggcacatggaaagtcctcaccgccgttgtgaataaacttgcc
gccaatttgactaaccaagtgcgaagcatcgcaaaagtcacgaaagccgtagcaaagggt
gatttatcggaaaccatcgacgtagaggcgagcggtgaaattgcagaattgaagactaca
gtcaatggaatggtcatgtctcttagaacgttggcagacgaggtcagcagagtgtctttg
gaagtcggtagtcaaggaaaactgggaggccaagccaatgtgccggatgtggagggagta
tggaaagatctaactgtcaatgtgaatcgaatgtgtgaaagtttaacgacgcaggtgcga
tcaatcggcagtgttaccacagctgttgctagaggtgacttaagcaagatgattgagatt
gaagcagagggagaaatggccgtcttgaagaatactgtcaattcaatggttcggcaacta
actgtattcgccaaagaagtaactcgagttgcgttagaagtcggtacccatggccagctg
ggcggtcaagccgtcgttcccggtgttgaaggcgtatgggacgatctcacaaccaatgtc
aacaagatggccaggaatctgacagatcaagtgcgggagattgccatggtcacaaaagct
gtcgctcggggtgacttatccaagacagtcaatgccgacgtacagggtgaaattcttgac
ctgaagtgtactgtgaatgaaatggttgcccaactgacggtattcgctgccgaggttact
cgtgtatctcttgaagttggaacggaggggaaattgggtgggcaagccgttgtgcccaac
gtggaaggcacttggatggttcttacggataacgttaacctaatggcattaaacttgact
actcaagtgcgttccgttgctgaagttacaacggccgtcgctgctggtgatcttagcaag
aagatcaacgtcgccgcgttcggcgagattctcgagcttaaaaatacggtcaataacatg
gtggattcactacgttcgttctcatccgaagtcacccgtgttgcgcgagaagtcggaacc
gatggccgactaggtggtcaggccaaggttcctggagtggccggtacttggaaggacttg
acagattgtgttaacatcatggcggccaatttgactgaacaggtccgaaccatcgcgcat
gccactactgcagtagctcgtggtgatttgactcaaaaggttgtcggcgtcaaagtatcc
ggagagatcctcgatctggtgaacacaatcaataatatgattgaccagttagctatattc
gcggcagaagtgacgcgtgtcgctagggaagttggtacagaaggaaagttaggagtgcag
gccgaggttgaaaacattgaaggaacctggcaagagatcacatccaacgtgaacaccatg
gcctcgaacctgacatcccaagttcgagcttttgctcaaatttccgcagctgcaacagat
ggtgacttcacaagattcatcactgttgaggcgtctggtgaaatggatagtctaaaaacg
aagatcaatcagatggtctacaatctcagagagtccattgagaagaacaccaaagcgaga
caggaagctgaaatggccaacagaagtaaatccgagttcttggccaatatgtcccatgag
attaggacgccgatgaacggtattatcggcatgacggtgttgactctggaaagcgaattg
actaggcaacaacgagagaatttgatgattgtctctagtttggctggatccctgttaacc
atcatcgatgatatcctcgatatttctaagattgaggcgggccgcatgaccatggaacaa
atcccattctccctacgtgttgccgtcttctccgtcctcaaaactctatgtgtcaaggca
gcccagaataagctggatctcatctttgacgttgatcccacgatgcctgatcaacttatt
ggtgatccacttcgtcttcgtcaagtcattaccaacctcatcggtaacgccgtgaagttc
actaccaaaggtcaagtagctctttcttgtcgagtcaagcgctacgtgaccgtcgccgac
gctgttgagcttgaattctgtgtggcggacacgggtattggtatcaagcaggataagctt
gatgtcatttttgacacctttgcgcaagcggatggatctaccactcgcaagtacggtggg
actggcctgggattgaccatctccaaacgactagtaaatctgatgagtggcgacctttgg
gttgagtcggaatatgggcagggaagtagattctatttcactactgttgcggaaatgact
agcgtaccgagggatcaaataatagagcggctatcgccttggtcgggcagaagcgtcttg
tttattgacacacttggtgaccagacgggaatcgtggaaatgctccaagaacttggttta
aagcctattgttatccattctgtgaacgatgtgtatcttttgcaggatcaaggcttgacg
gtatttgacacgatgatcgttgattctctcaaagctgcgggagaactgagaggcatagaa
tatcttcgctacatccccattgttcttcttgcaccatcgaacaaaccaagtggaccctct
aatccatcttttatctcacttcccgaatcgcgccgccgtcttcttgcccttccttccgcc
tccgaacaacttctctcacctatacccgtcaaggattgcttagagatgggtatcaacacg
tactataccacccctctctccttacaagagttatccaacgcgatcgtccctgcgctggaa
tcccatcagatccaaccaggagacactgttaaggacactatcctcagcgtgttgcttgcg
gaagacaacctagtgaaccagaagctggctgttaagttgatggaggtcgccggtcataag
atcgaagttgccgacaatggtgaaattgcattagagaaatacaagaggcgacagctggct
agaacaccatttgacgtcattctgatggatgtttcgatgcctgtgatgggaggcatggaa
gccacgggtctgattcgcgagtttgaagcgaatgagggcgtacctcgcacgcctattatt
gctcttacagcacacgcgatgatcggtgacaaggagagatgtcttgcggctggcatggat
gaatacgtcacgaagcctctgagaagaggcgatttattggcatcaatagccaaagtacta
gctcccaagcagtctgccagcggcttggaaatgccagccgtacctattccagcaaatatc
tatggtagataa

DBGET integrated database retrieval system