KEGG   Cryptococcus neoformans var. neoformans JEC21: CNC06460Help
Entry
CNC06460          CDS       T00243                                 

Definition
(RefSeq) RNA helicase, putative
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CNC06460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cne03019]
    CNC06460
   03036 Chromosome and associated proteins [BR:cne03036]
    CNC06460
Enzymes [BR:cne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CNC06460
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNC06460
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     CNC06460
Chromosome and associated proteins [BR:cne03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    CNC06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 3256118
NCBI-ProteinID: XP_569901
UniProt: P0CQ80
Position
3:complement(join(1878867..1879607,1879660..1879983,1880032..1880160,1880206..1880631,1880681..1880706,1880757..1880904,1880956..1881022,1881069..1881085))
Genome map
AA seq 625 aa AA seqDB search
MASSSTLLNDDWKQGLAAPPKDLRPQTEDVTATQGSRFEDFGLRRELLMGIYTAGFERPS
PIQEQAIPMALTGRDILARAKNGTGKTASFIIPTLNRINTSLSHIQALILVPTRELALQT
SQVCKTLGAHIPNLQVMITTGGTTLRDDILRLQQPVHILVGTPGRILDLGSKGIASLNKC
GVFVMDEADKLLSEDFMPVIEQTLALCPQERQVMLFSATFPWTVKEFKDQHMVQPYEINL
MDELTLKGVTQYYAYVEESQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKVTELGYS
CFYSHAKMQQAHRNRVFHDFRNGMTRNLVCSDLLTRGIDIQAVNVVINFDFPRTAESYLH
RIGRSGRFGHLGLAISLLTLEDRHNLYRIESELGTEIAPIPAVIDPVLYVAPAMVEEERE
SPPPKPAAIAAPPAQQQPQQRQRQHPPVPSHQAAQQSPAAAPVQQQQQQQQQQQQQQQQQ
QPQYQQAYGQGPPQPQALFQQQPNSSPAPAPLPSYSQQAPTQAQGPAPVQSPPPAPSTQP
QAPAQTPIQGQIPPTQPRAQQQGQQQPGQPGQAQGQSQPNRRPNTGGFRGNGRGQGHRGR
GRGRGGQPGQPGAGAGAGQSQQAQA
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcctcaacgttactgaacgacgactggaaacagggtcttgctgcccctcct
aaagaccttcgtccccaaactgaggacgttaccgctactcaaggatctcgtttcgaagat
tttggcttacgccgagaacttttgatgggtatctacactgctgggttcgaaagacctagt
cctatccaagagcaagctatccctatggcccttacaggacgagatattcttgctcgagcg
aagaacggtactggaaagactgcttctttcattattcctacccttaaccgaatcaacact
tctctatctcatattcaagcacttatcctagttcccacccgagaactcgcccttcaaaca
tcccaagtctgcaaaacccttggtgctcacatccctaacctccaagttatgattaccacc
ggcggtaccacattacgtgacgatatccttcgtcttcaacaacctgtccacattctcgtc
ggtacacccggtcgtatcttagatttgggaagcaagggaattgcgagtttgaacaagtgc
ggtgtctttgttatggatgaagcagacaagcttctcagtgaagatttcatgcctgtcatt
gagcagactttggctctgtgccctcaagagagacaggttatgctgttctctgctactttc
ccatggaccgtcaaggaattcaaggaccaacacatggttcaaccatacgaaatcaacctc
atggacgaacttactcttaaaggtgtcactcaatattatgcctatgttgaagaatctcag
aaagtccattgcctcaacaccctcttctctaagctccaaatcaaccaatctatcatcttc
tgcaactccaccaaccgtgtcgagctcctcgccaagaaggtcactgaacttggctattcc
tgtttctactcccacgcaaagatgcaacaagcccaccgaaaccgagttttccacgacttc
cgtaacggcatgactcgaaacttggtctgttccgacttgttgacaagaggtattgatatc
caggccgtgaatgttgtcatcaactttgacttcccaaggactgcagaatcatatcttcac
aggatcggccgatctggtcgttttggtcatttgggtcttgccatttctctcctcactctt
gaagatagacataacctgtaccgtatcgaatccgaacttggcacagaaattgcccctatc
cccgccgtcatcgatcctgtcctctatgtcgctcctgccatggtagaggaagagcgagaa
tcaccgccccctaagcccgctgccatcgccgctcctcccgctcagcaacaacctcaacaa
cgacaacgacaacaccctcctgtgccttcccaccaagctgctcagcagagccctgctgcc
gcgcccgtccaacaacaacagcagcagcaacaacaacaacaacaacaacaacaacaacaa
caacctcagtaccaacaggcatatggtcagggcccaccccagcctcaagcccttttccag
cagcagcccaattcttctcccgccccggcacctttgccttcttattctcaacaggctccg
actcaggcccagggacccgcgccagtgcaatctccacctcccgcgccttccactcagccc
caggcccctgctcaaacccccattcaaggccaaatccctccgactcagccccgagctcag
caacaaggccagcaacaacccggtcaaccaggtcaggcgcagggtcagagtcaacctaac
agacggccgaatactggtggctttaggggtaacggacgaggtcaaggacatagaggacga
ggtagggggaggggaggacagcccggtcagcctggtgccggtgccggtgcgggccagagc
caacaggctcaagcctaa

DBGET integrated database retrieval system