KEGG   Cryptococcus neoformans var. neoformans JEC21: CND00480Help
Entry
CND00480          CDS       T00243                                 

Definition
(RefSeq) protein phosphatase inhibitor, putative
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00770  Pantothenate and CoA biosynthesis
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CND00480
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CND00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein RRM_3
Motif
Other DBs
NCBI-GeneID: 3257341
NCBI-ProteinID: XP_024512717
Position
4:complement(join(141765..142207,142327..142501,142578..142667,142734..142772,142840..143001,143087..143284))
Genome map
AA seq 368 aa AA seqDB search
MSSTSQTTNARLSRLPRKPPRPFISAHHRPPTRNHTTTDNIFRVLLISSGSVASIKIPNI
VEELVKVGNIDIQIIATKASTHFYSQEDVDKSVQSALNLSDEEMQDDVGVRIWTDEDEWS
DWKKVGDPILHIELRRWADIVVVAPCSADLLAKISCGLCDTLASSFLRALSSSTPVVICP
AMNTHMYQHRLTAKHLAVVQDELGYLVSGPQGAGRLACGDDGPGKMTDWHDIVSLIQGFA
TMHQTQVSLASLTFPSLSMPYPSASASPSDTFIDTPSPPPASADTSTYNLPHRFPCGASS
NLPQQREKEKGIGEHPTMVVPLPDPHPLSTEAALNGEKMPASVYAKNVDWEKLANDGGLW
HRKWWLGV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaccagccagaccacaaatgcacgtctgtcccgtctccctcgtaaaccacct
cgcccattcatctctgcccaccaccgtcctcctactcgaaatcataccacgaccgacaac
atcttccgtgtcctcctcatctccagtgggagcgtcgccagtattaaaatacccaatatt
gtggaagaactagttaaagtgggcaacattgatatccaaattatagccaccaaagcttca
acacatttctactcacaagaagacgtagacaaatctgtacaatcagcattaaatttgtcg
gacgaggaaatgcaagacgacgtaggagtgagaatatggacagacgaagacgagtggtcg
gactggaagaaagtcggagacccgatcctacacattgaattacgacgctgggcggacatc
gtcgtggtagccccatgttcagccgacttactcgccaagatttcgtgtggattatgtgat
acccttgcctcatcttttctccgcgccctatcatcatccacacccgtagtcatctgccca
gcaatgaacactcacatgtatcaacaccgcttgaccgccaaacaccttgctgtcgtgcaa
gatgaattaggataccttgtttctggaccacaaggggcaggaaggcttgcttgtggtgat
gatggcccaggcaaaatgacagactggcacgatatcgtctctcttatccaaggattcgcc
acaatgcaccaaacccaagtctccctcgcctcattaacctttccttctttatccatgcct
tacccttctgcatctgcgtctccaagtgatacttttatagatactccttcccctccccct
gcatctgcagacacgtccacctacaacctcccacatcgcttcccctgcggagcaagctca
aatcttccacaacagagggaaaaggaaaagggaattggggaacatcctacaatggttgtg
cccttaccagacccgcatccattatcgacagaagcagcgctcaacggtgaaaagatgcca
gcatcggtatatgccaaaaatgtggattgggaaaagttggccaatgatggtgggttgtgg
catcgaaaatggtggcttggtgtctga

DBGET integrated database retrieval system