KEGG   Cryptococcus neoformans var. neoformans JEC21: CND00900Help
Entry
CND00900          CDS       T00243                                 

Definition
(RefSeq) pre-mRNA splicing factor, putative
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CND00900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cne03041]
    CND00900
Enzymes [BR:cne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CND00900
Spliceosome [BR:cne03041]
 Complex C
  Other components
   Step II factors
    CND00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 AAA_22 DEAD AAA_30 T2SSE AAA_19 DUF2075 AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 3256928
NCBI-ProteinID: XP_570324
UniProt: Q5KJ25
Position
4:complement(join(279101..279151,279205..279365,279417..279536,279594..279668,279720..279758,279818..279920,279983..280492,280538..281061,281115..281238,281287..281529,281584..281911,281965..282125,282174..282372,282422..282578,282632..283283,283333..283455))
Genome map
AA seq 1189 aa AA seqDB search
MMSTDKELYKLELLSLVSKVSQELFNHTKLQDKKLAEFVIALHEQSKTTEAFQKKLNEIG
ADFPEWFVKNLDRLIVTMHPKYKRKAAKMKASKQSGKSDDGQSVMEEQKQLQARKFPGLS
MPDQDWKPAEKYVDERAAKEPHETLPESLSTSDTMAQLESIASRRNRPAAEDFLDGEPAA
KKLRSATSSGHDGSSGRRGGYEGGSFRDSFRHGRPTVDERPVLYKIYNGTIANITDFGAF
VTLDGVERKIDGNQRSNEGLIHVSNITNGRVNSPRDFLKRGQRVKVKVMAVSPKIGLSMK
DVDQNTGDDLSPHLTVKTAEEAAVQQQRMSSYAASGSNSTPLLAVDERQRSSAKRLSSPE
RFEIKQLIASGAVSAADYPDLDEDFSTNVANHEIEEDIDVEVNEVEPAFLSGQTKVTLEL
SPVKIIKAPDGSLNRSALAGASLAKERRDLKRLEANEQADAETREINQPWLDPMANQNER
QFASDIKGNLLGQKAAQMPAWKAANKVVSYGKITSMSIQEQRRSLPIYKLREQLVAAIRD
NQILVVVGDTGSGKTTQMAQYLAEEGFLEKGRLGCTQPRKVAAVSVAKRVAEEVGCRLGA
EVGYTIRFEDMTSPETKIKYMTDGMLLRELLVDPDCSKYSVIMLDEAHERTIATDVLFGL
LKKACKRRPDLKLICTSATLDAAKFATYFWGCPIFTIPGRTYPVETLYTKEPEPDYLEAS
LITILQIHLMEPAGDVLLFLTGQEEIDTACEVLYERVKALGPQVPELLILPVYAALPSEM
QSRIFEPAPPGARKVVIATNIAETSITIDGIYYVIDPGFAKQNAYDPKLGMDSLIVTPIS
QAQARQRAGRAGRTGPGKCYRLYTEVAYRNEMLPNPIPEIQRTNLASTILTLKAMGINDL
ISFDFMDPPPAATMLTALEQLYALGALDDEGLLTRIGRKMADFPLDPPLSKMLIKSVDYG
CSEEALTIVAMLQAGGQVYYRPKDKQTQADAKKAKFHQPEGDLLTLLAVYNGWKNSKFSN
PWCFENFIQTRAMKTAQDVRKQLIGIMDRYKHDLVSCGTNYNRVRMAICSGFFRNAAKKD
PTEGYKTLVEGTPVSIHPSSALFQRPPEWCVYYELVLTAKEYMHQVTVIEPKWLSEVAPT
FFRIADQNKISKRKASEKIEPLFDRFAADKDDWRLSKQKKAARSSQTFG
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccactgataaagagctgtataagctcgagcttctctcgcttgtatcgaaggtg
tcccaggagctcttcaaccacactaagcttcaagacaaaaaactagctgaatttgtgata
gcacttcacgaacaaagtaaaacaactgaagcgttccagaagaagctcaatgagatcggc
gcagactttcccgaatggtttgtcaagaatctcgacagactgatcgttaccatgcacccc
aagtataagaggaaagcggccaagatgaaagcctcgaagcagtcaggaaagtctgacgat
gggcaatctgtcatggaggagcagaagcaacttcaggcgagaaagtttcccgggttgtcc
atgcctgaccaagattggaagcctgccgagaaatatgtcgacgaaagggccgcaaaagaa
ccgcacgagacccttccggaatcactttcgaccagtgatactatggcccagttagagtcg
atcgcgtctcgccgaaatagaccggcggctgaggatttcttggacggggagcctgctgcg
aagaaattgcggagtgccactagcagtggtcatgacgggtcgtcaggacgacggggcgga
tatgaaggaggcagctttagagattcttttagacatgggcgtccgacggttgatgagagg
cccgtactctacaagatctacaatggcactatcgcgaatatcaccgattttggggctttt
gtaactttagatggcgtagaaagaaaaatcgatggtaatcaaaggtcaaatgaaggctta
atccatgtatcgaatattacaaatggaagagttaactcaccccgagacttccttaaacgg
ggtcaacgagtcaaagtcaaagttatggctgtcagtcctaagatcggtctaagtatgaag
gatgtcgatcagaacactggtgatgatctttccccacatcttactgtcaagactgctgaa
gaggccgcagtgcagcagcaaaggatgtcatcttatgcagctagtggaagtaacagcacc
cccctcttagcagttgatgagcggcagcgatctagtgcaaagagattatcaagtcccgag
cggttcgagattaaacagctcatagccagtggggccgtatctgcagcagattaccctgat
cttgatgaagacttcagcactaacgtcgccaatcatgagattgaagaagacattgatgtc
gaagttaatgaagtcgaaccggcgttcttatcgggccagaccaaagtcaccctggaactc
tctcctgttaaaatcatcaaagcaccagacggctcacttaaccgttctgctttagcaggc
gcttcattggcgaaagaaagacgtgatctcaaacgtttggaagcgaatgagcaggccgac
gcagagaccagagagatcaaccagccttggcttgatcccatggctaaccaaaacgagcgg
cagtttgcatcagacatcaaagggaacctgcttggccaaaaggccgctcaaatgcctgcc
tggaaagctgcaaataaagttgtgtcgtatggcaagatcacttctatgagtatacaagaa
caaagacgcagtctgcccatctacaaattacgggagcagttggtcgccgctattcgagat
aatcaaattcttgttgtagttggagacactgggtctgggaagactactcaaatggcgcaa
tacctcgctgaagagggattcctcgaaaaagggcgtttgggatgcactcagccgcgaaag
gttgctgctgtttctgtcgctaagcgtgttgcagaggaagtgggttgtcgactcggggct
gaagtcggctacactatccgttttgaagatatgaccagtcctgagaccaagatcaagtac
atgaccgatggtatgcttcttcgtgaattgctggttgatccggattgctcgaaatactct
gtgattatgcttgatgaagcgcacgagcgcacaatcgcaactgacgtcctcttcggtctc
ctgaaaaaggcttgcaaacgacgcccagatcttaagctaatatgtacttctgccacactg
gatgctgccaagtttgcgacctacttctggggttgcccaatctttaccattcctggccga
acataccccgtcgagacactttatacaaaggagcctgagcccgactacctggaggcctct
ctcatcaccatccttcaaatccatctcatggaaccagcaggcgatgttcttcttttcctt
acaggtcaagaggagatcgatacagcatgtgaggttctatatgagcgagtcaaggcattg
ggtcctcaagttccagagcttctcattttaccggtatatgctgcacttccctctgagatg
cagtcacgcatctttgagccagccccacctggtgcacgtaaggtggtcatcgcaaccaac
attgcagagaccagtatcaccattgatggcatatactatgtcattgatcctggttttgca
aagcagaatgcttatgacccaaagcttggtatggattctttgatagtcactccgatctcc
caagcgcaagcacgtcaaagagctgggcgtgccggccgcacgggccctggcaagtgctat
cgtctctacacagaggtcgcctaccgtaatgaaatgttacccaacccaattcctgaaatc
caacgaaccaatcttgcatctactattctcactctgaaagcaatgggaatcaacgatctt
atcagtttcgatttcatggatcctcctccagcagcaaccatgttaacagctttagaacaa
ctttatgctcttggtgccttggatgatgaagggctgttgaccaggattggtcgaaaaatg
gcagattttcctctagaccctcctttatccaagatgcttatcaaatctgttgattatgga
tgttctgaagaagccttgacaattgtggctatgctgcaagctgggggccaagtatactat
cgacccaaggacaaacagactcaagcggacgccaaaaaggctaagtttcatcagccagaa
ggtgaccttcttacattacttgctgtctataatggatggaaaaactcgaaattcagtaac
ccatggtgcttcgaaaactttattcaaacacgagccatgaaaacagcgcaagatgtaaga
aaacagttgattggaattatggatagatataaacacgatcttgtgtcatgtggtaccaat
tacaaccgagtacggatggccatttgctctggattcttcagaaatgctgccaagaaggac
cccactgaaggttataagacacttgttgagggtacacctgtcagcattcatccctcaagt
gccttgttccagcgaccccctgaatggtgtgtgtattatgaactggttcttactgccaag
gaatacatgcaccaggtcactgttattgaaccaaaatggctttctgaagtggcaccaaca
ttcttccgtattgctgatcaaaacaagattagcaagcgtaaggcatctgagaagattgag
cctctgtttgatcgttttgctgcagataaagatgactggcgtctcagcaagcagaagaaa
gcagctcgctcttcacagacttttggttga

DBGET integrated database retrieval system