KEGG   Cryptococcus neoformans var. neoformans JEC21: CND04250Help
Entry
CND04250          CDS       T00243                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00450  Selenocompound metabolism
cne00970  Aminoacyl-tRNA biosynthesis
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CND04250
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CND04250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cne01007]
    CND04250
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cne03016]
    CND04250
Enzymes [BR:cne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CND04250
Amino acid related enzymes [BR:cne01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CND04250
Transfer RNA biogenesis [BR:cne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CND04250
 Prokaryotic type
   Other AARSs
    CND04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 DUF4407
Motif
Other DBs
NCBI-GeneID: 3256886
NCBI-ProteinID: XP_570588
UniProt: Q5KI46
Position
4:join(1180723..1180793,1180852..1180901,1180971..1181007,1181062..1181125,1181179..1181220,1181267..1181337,1181389..1181587,1181642..1181999,1182046..1182165,1182213..1182514,1182567..1183427)
Genome map
AA seq 724 aa AA seqDB search
MSVRNIREAEGLLMEVHDPSKGPVLPKDGQRNVLITSALPYVNNVPHLGNIIGSTLSADV
FARYNRTLNVPTLYICGTDEYGTATETKALEEGVTPYELCTKFHKLHTEIYEWFQISFDK
WGRTSSPEHTEITQGIYRRLHDNGLFRLETTDQTYCVDDKLFLADRFVEGICPNCGYDDA
RGDQCDKCSLTFSSPTQLLNPRCKRNKAHTLSVRPSTHACYRLDLLQPRLVEWMQKARVK
GKWGTNAVITEKGEIVEPRMLGEGLRPSAVTRDLKWGVEVPKVGDEEEDKAMEGKVIYVW
FDAPIGYPSITATYTEEWEKWWKNPDNVELYQFMGKDNVYFHTVLFPAMLLGTEERWTML
HNISSTQYLNYEDTKFSKSRNVGVFGNNARETGQPPEIWRYYLISQRPENSDSSFLWSKF
IAANNNELLANLGNFVNRVVKFINAKLDSKVPGPEDFAGGEVAPPADSLDVDFVTDVNTR
LKEYREQMDDTKLRGGLATAMALSARGNQYLQENSLDNALLASNPKRCAEVLLNAVNLIY
VLSVVFHPFMPNTSEGILRQLNAPARSLPTKFSIDILPGHVLGKAEYLFKKIDNVNGEQE
KKWQRQYGGDAVVADHVAPPGPGGHPEGGKVPKVKDTDAESKKAAHEARRAQLAKEKKAA
QAAADAKKTPEEKELEAKVEAQGKRLAAIKKGLEEGDAEKEMSVAKSLKTELADLRKRLK
GTTI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtccggaatatcagagaagccgaaggtctcctcatggaggtccatgacccctct
aagggcccagtcctcccaaaggacggacaaagaaacgtccttatcacttctgcgttacct
tatgtgaacaacgtaccacaccttggcaacatcatcggctctactctttccgcggacgtt
tttgcgagatacaatcggacactcaacgtaccgaccctttatatttgcggaaccgacgag
tatggaaccgctacggagacgaaggccttagaagaaggtgtcaccccatacgaactctgt
accaaattccacaaattgcatacagagatttacgagtggttccagatcagcttcgacaaa
tgggggcgtacttcgtctccggaacatactgagatcacccagggaatttacagacgtctc
catgataacggccttttccgtctggaaaccaccgaccagacttattgtgtagatgacaag
ctctttttggctgatcgctttgtggaaggcatctgtcccaactgcggctatgatgatgcc
cgaggtgaccagtgtgacaagtgctcgctcaccttttcatcccctactcaactccttaac
cctcgctgcaaacgcaacaaggcacacaccctctctgttcgaccctctactcatgcctgc
tatcgtttagacctgctccagcctcggctggttgagtggatgcaaaaagcccgtgtcaag
ggaaagtggggaacaaatgcggtcatcactgaaaagggtgagattgtggagccgaggatg
ctaggagaaggtttaaggcctagtgccgtgacgagagatctgaaatggggtgttgaagtt
ccgaaagtcggagacgaagaggaggataaggccatggaaggcaaggtaatctacgtttgg
ttcgatgctcctatcggctatccttcgatcacagcaacctataccgaagaatgggaaaaa
tggtggaagaatcctgacaatgtagagctctatcaattcatgggcaaagacaacgtctac
ttccataccgttctctttccggctatgctgcttggtaccgaagaacgctggaccatgctt
cataacatctccagcactcagtatctgaattatgaggatacaaagttcagcaagagtagg
aacgttggtgtgttcggcaacaatgctcgagagacaggacagcctcctgagatttggagg
tattatctcatctctcaacgaccggagaacagcgactcctcctttttgtggtccaaattc
attgccgctaacaacaatgagcttttggccaatctgggcaactttgtcaaccgagtggtc
aaattcatcaacgcgaaactcgattctaaggtacccggtccggaagatttcgccggtggc
gaagttgctccccctgctgattctctagacgttgattttgtgactgatgtcaacacccgc
ctcaaagagtaccgcgagcaaatggatgacactaaacttcgcggtggtcttgcaacggca
atggctctttctgctcgtggtaaccaataccttcaagaaaattctttggacaatgccctt
ctcgcaagcaaccccaagcgatgtgccgaggttttgctcaatgctgtaaacctcatttat
gtcctgagcgtggtgttccacccctttatgccaaacacatctgaaggtatcttgcggcaa
ctcaacgctcctgcccgatccctgcccactaaattctctattgatattcttcccggacat
gttttgggtaaagccgaatatttatttaagaagatcgataacgtcaatggagagcaggag
aagaaatggcaaaggcaatacggaggagatgctgtggtagcagatcacgttgcgccacca
ggtccaggcggtcaccccgaaggcgggaaagttccgaaagtcaaggataccgacgcagag
tccaaaaaggctgcgcacgaagctcgcagagcccaacttgcgaaagaaaaaaaggctgct
caggctgctgctgatgcgaagaagactcctgaggagaaggagttggaggcaaaggtggag
gctcaaggcaagaggctagcagcgatcaagaagggattagaagaaggtgacgctgagaaa
gagatgagcgtcgcgaagagcttgaaaactgagttggctgatttacgaaagaggctgaaa
ggaactaccatttaa

DBGET integrated database retrieval system