KEGG   Cryptococcus neoformans var. neoformans JEC21: CND04800Help
Entry
CND04800          CDS       T00243                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00230  Purine metabolism
cne01100  Metabolic pathways
Module
cne_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CND04800
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CND04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_16 AAA_33 RsgA_GTPase AAA_18 ABC_tran Septin AAA_24 MMR_HSR1 AAA_29 AAA_21 FtsK_SpoIIIE RNA_helicase AAA_28 AAA_14 Rad17 ATPase_2 AAA_23 AAA_30 AAA NACHT cobW Adeno_IVa2 AAA_19 Roc IstB_IS21
Motif
Other DBs
NCBI-GeneID: 3257355
NCBI-ProteinID: XP_570490
UniProt: Q5KHZ1
Position
4:complement(join(1318431..1318824,1318877..1319100,1319155..1319190))
Genome map
AA seq 217 aa AA seqDB search
MSRPINPDVVNRPLVICGPSGTGKSTLLKTLFESQPDTFGFSVSHTTRKPRPGEENGREY
HFVTKEEFMEGVGKGEFLEWAEFGGNCYGTTFAALTALHPRRCILDIELQGVLQLKAKAP
LQTPPLEPVFLFLSPPSISQLKSRLSGRGTETDASIRKRLDAAKEELRYAKEGKYDVYVV
NDDLKVAGEKLEKVAMGWEGWKTCGDVLPELNLAELD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcccatcaatccagacgtcgtcaaccgcccacttgtgatttgcggcccttct
ggtaccggaaaatctaccctcctcaagactctttttgagagccagcctgatacctttggt
ttttccgtctctcatactactcgaaagcctaggcccggggaggaaaatggccgagaatac
cactttgtcaccaaggaagagtttatggagggtgtcggcaagggcgaatttttggagtgg
gccgaattcgggggcaattgttacggaactacatttgctgccttgaccgcccttcatccc
cgccgatgcattctcgacattgaactgcaaggtgtccttcagctaaaggctaaggccccg
ctccaaacccctcccctcgaaccggtgtttctcttcctttctccgccttccatttctcaa
cttaaatcccgtttgtctgggcgaggtaccgagaccgacgcctccatccgaaagaggctc
gatgctgccaaggaggagctgaggtacgcgaaggagggcaaatatgatgtttacgttgtc
aacgatgatctgaaggtggctggcgaaaagcttgagaaagttgcgatgggttgggagggc
tggaagacttgcggtgacgtcttgccagagctgaacttggctgaacttgactaa

DBGET integrated database retrieval system