KEGG   Cryptococcus neoformans var. neoformans JEC21: CNE00140Help
Entry
CNE00140          CDS       T00243                                 

Definition
(RefSeq) transketolase, putative
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00680  Methane metabolism
cne01100  Metabolic pathways
cne01200  Carbon metabolism
Module
cne_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CNE00140
Enzymes [BR:cne01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     CNE00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N DUF1985
Motif
Other DBs
NCBI-GeneID: 3257936
NCBI-ProteinID: XP_570699
UniProt: Q5KHG5
Position
5:join(26957..27031,27080..27142,27194..27305,27349..27504,27553..27726,27778..27944,27992..28522,28584..28699,28746..28867,28925..29409,29462..29623)
Genome map
AA seq 720 aa AA seqDB search
MTATRNTNGHGELNREAHTTNKVVSEKEEQLVLNTIRCLAADLCQQYKGGHPGTVMGASA
IGIALWRYEMRYNPLNPDWFNRDRFVLSAGHACLFQYIFLHLSGYEAWTLDQIKMYHSPA
TSGSMAAGHPEIEYPGIEVTTGPLGQGISNAVGMAIASKQLAATYNREGLDIVDNKIWCF
TGDGCLQEGVGQEAISLAGHLGLDNLILVYDNNAVTVDGRIDNCFTENTSKKLQAQGWNV
IDVYDGSNDLAAILEGFDKAKQFKGKPSLVNIRTVIGYSSRKANTGPAHGQALGDDEVAY
VKTQLGFDPAQKFVIPDKAYEYFAECKIKGAKANEEWNEKFEAYSKAYPDLYKQLTDRMN
GRFAPDGWETLLPAKKDLPQGDQPTRKSSGIAVQTLVPKNNTFIAGSADLLESTFVNFDG
QVEFQNPSSGLGDYTGRQIRFGIREFAMVGLGNGMAAYHKGMFIPIMSTFFMFWIYAAPA
ARMAALQHLRFIGVATHDSIGIGEDGPTHQPIALAAFYRALPNINLIRPADAEECMGMWL
LALSDQSANTPSIFALSRQPVPLLSGTDRTKVAQGAYIVYGDDRSPDMTIIATGAEVARA
IESAKLLKSVKKVRVVSMPSQKHFDIQTAEYKELVLKSSTALVVAIEAWASYGWARYAHA
SLSMQTFGHSAPQQQLYEHFGFSPKAMAEKIDEWAARWQTKGGRPGLGDFEELLLRYTQH
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccagaaacacgaatgggcacggagagctgaaccgggaggctcacacaacc
aacaaagtagtttccgaaaaagaagaacaattggtgctgaacacgatacgatgccttgca
gcagacttgtgtcagcagtacaaaggcggtcatcccggtactgttatgggtgcctcagcc
atagggattgccttgtggagatatgagatgagatacaaccctctaaaccccgactggttc
aatcgagaccgcttcgtcctttcggctggacatgcttgtcttttccaatatattttcctc
catctttccggctacgaagcttggacattggaccaaatcaagatgtatcactccccagcg
acttcgggatctatggccgcaggacaccctgagatagaatacccaggtatcgaggtgaca
actggacccctcggacagggtatctctaacgcggtcgggatggcaattgcatcaaagcag
cttgcggcgacatacaacagggaagggctggatatagtggacaacaaaatctggtgtttc
accggtgatggctgtttacaagaaggtgttggccaggaagccatttcgctggcagggcat
ttgggattggataatttgatcctggtatatgacaacaatgctgtcacggtagacggccga
atcgacaactgttttaccgagaacacttcgaaaaaactgcaagctcaaggctggaatgtc
atcgacgtctatgatggctcgaacgatcttgccgcgatcctagaagggtttgacaaagcc
aagcagttcaaagggaaaccaagtctggttaatatacgtacagtcattggttactcctca
cgaaaagccaacactggaccggcccatggtcaagccttgggagacgatgaagtggcatat
gtcaaaactcaactcggattcgatcctgctcagaaattcgttattcccgacaaggcatac
gaatatttcgctgaatgcaaaatcaagggtgcaaaggcaaacgaagaatggaacgaaaaa
ttcgaagcctactcaaaggcgtatccagacttgtataaacagctgactgatcgaatgaac
ggcagatttgctccagatggttgggaaactctgttaccggcgaaaaaggatcttccgcaa
ggggaccagcctaccaggaagtcaagtggaatcgcagttcaaactttggtgcccaagaat
aataccttcatcgctggttcagcggacctcctcgaatccacctttgtcaatttcgatggt
caagtagagttccagaacccttcttcgggtctgggagactacactggcagacaaattcgc
ttcggcattagggagtttgcaatggtgggtttgggcaacggtatggcagcatatcacaag
ggaatgttcatccctatcatgtctacgttcttcatgttttggatctacgctgccccggcc
gcccgaatggccgctttacaacatctgcgattcatcggagttgccactcatgattccatc
ggtataggggaagatggtcccacccatcagcccatcgctctggctgctttctacagagcc
ttaccgaacatcaaccttatccgacctgccgatgcagaggaatgtatgggaatgtggctc
ttggctctatcggatcaatcagcaaacacccccagcatcttcgccttgtctcgacaaccc
gtgccccttctttccggaaccgaccgtacaaaggtcgcacaaggggcttacattgtttac
ggtgatgacagaagtccggatatgacgattattgcaaccggtgctgaagtcgcccgagca
atcgagtctgccaagctgctgaagtcggttaagaaggtccgagtagtctcgatgccttcc
cagaaacatttcgacattcaaactgcagaatacaaagaattggttctaaagagctccacc
gccctcgtggtcgcaattgaagcatgggcttcttacggttgggctagatacgcacatgct
tcgttgtccatgcagactttcggtcactcggcacctcaacagcagctgtatgagcatttc
ggattctctccgaaagccatggcagagaagattgatgagtgggcggccaggtggcaaacg
aaaggaggccggccaggacttggtgatttcgaagagctgttgctgcgctatacgcaacat
tga

DBGET integrated database retrieval system