KEGG   Cryptococcus neoformans var. neoformans JEC21: CNE01530
Entry
CNE01530          CDS       T00243                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K24738  WD repeat-containing protein 7
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cne04990]
    CNE01530
Domain-containing proteins not elsewhere classified [BR:cne04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   CNE01530
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 3257886
NCBI-ProteinID: XP_024512833
Position
5:join(416517..417541,417594..417762,417819..417996,418056..418492,418550..418669,418722..418786,418834..419054,419106..419307,419361..419516,419572..419754,419809..420093,420149..420264,420320..420430,420481..420579,420631..420736,420783..421268,421323..421394,421443..421684,421735..421841)
AA seq 1459 aa
MPSPPPPLTIPILLHPTLPSQARHALPLRPTHIAHWTVNSNHGQSAYTALATQDNTIWVV
ADQPAPPLDDHDLLQEETSTHIPSIYTSSPISPRRARPAPARPHTPSQRPGATSTASTAG
SSSQRRTSAFSPPLSAHQLPTATLSSATASAAPPDQHVHRSSLSGRMELMGQLREHNGGR
ENTGIGAGLGIGRRGLTGLHGQAEQDSGTTSPKSSMSLSTETTSTVGMFSFWQKGSQSDA
EEKGREIDEIMQEINVDREMENERRESEKESEDLKVVEAAIERSPSSGQGYNLPGSHAKS
HGCEWGNKKVWRIVLRRVDRGKIVSLTAFEELGILCVLRDEGLLEIFSLTTLQCVDYLEL
EGPNSRHLQKDPSNSNTAIVKLGQVWSWSGIHMARNDTSHILVAHGLPWPCETPSPNGEV
TRVIILLFNQDQQPLLDPIAKLELPGEGDVGLCQDGDTNYLIHATPTSLTSYPIIYSQHK
ASPSSSLQLHPGHSSAAYPSRSHTPNLESSDASSSLLRKSVSSSRLLDPHQSHPHEKEHS
FARFLARRTDWSKKKDEEHGDQPIIHPALGEGKEVERDGYGHWTRIKLHENGEGVGWADD
GIDEFQCDGKSLWIKGTISWTKRVSAREVVFSKGWKKIVILRADGKLAVYAPQGNEVPKE
GSRLKFEQKSIDDDVNAICLTESGKLLLSNVSAVQKGDIDSPVISFKKYLTLEEPPEEEN
GSFSHVVPYGVENVLVADRQGNVYLRKLDRVIHQDNIDPTTDDKPSVDRLDAAVTCMKIV
RGPEENDKKYLVAGDEDGVIRIWTVEEFQFCGSWTLFAWPVSDFVLLDMPQAGPLHGTLL
CTSQAGTVGIISLSEMEQLFLIPAARSPLRHIYLANTDILLAYANGKARVWNTETQEFRR
STGLDAAEDMLQAGNWTRVDLTKRHTQTPLTACVAQPYAASQLGRLLNLDLRELGRWLHS
SKNNPHHSPLPALRSLLSILFTFGVSDKVDETCIRNLGVHKPEKPIMVGYGSADTHEIVY
AQGVDSWRISERITGVRQLAIITVLRPFLDSPDLEQWAAEVIAFYTASLPPNIIEPDLEF
FASYYMDPSYDVHQAARLLFAARVGRLSGSEIDTVARTREHELPILQPEERKFCGSAANA
LTVLGGIALQKYQCMGPAALKALAESVALYLHEPNCDYISLAVELCSKGFTIWQSYVDPS
DLLRRLFHLATNKEPPSMSSHSSTSIAAQARLAILLVASSNPPLFMSTLSMDILDAKSAE
SRSSIMKLCVFMARKKPAVLENGLPRIAEAVVKSLDPNVGKMRDDVWQAATVILNELVLA
FSTIDFHSRTQRLAVGTHEGAVIMYDLKTASRLYVLEPHKAPASAVCFSPDGRRLVTVSI
EEGSVTVWKVGSSLSGFFNVGGPPRQGGEKGEPFKRIEFKRADDRPLDSTSALSDVQITW
LGARQARVTIKETALTFET
NT seq 4380 nt   +upstreamnt  +downstreamnt
atgccttccccgcctcccccactcaccatccccatccttctacatcccacactcccctcc
caagcaaggcacgcccttcccctccgccccacccacatcgcacactggacggtcaactct
aaccacggccaatcagcctatacagctcttgcaacgcaagacaataccatctgggtcgtt
gcggaccagccggcaccacctcttgatgatcacgacctattgcaggaagagacatctact
catatacccagcatctacacttcgtcaccaatttctcctcggcgcgctcgaccagcaccc
gctcgaccacatacaccatctcaacggcctggggcaacttctacagcatctacagcagga
tcatcctctcagcgtcgcacttccgccttttctcctccactctctgctcatcagttacct
acggctactctctcgtcggctactgcttctgctgctcctcccgaccagcatgtccaccgg
tccagcttatccgggagaatggagcttatggggcagctcagagagcataacggcggcaga
gagaatacaggaataggagcagggctgggcattggacggagaggtctgacaggtttacat
ggccaagctgagcaagattccgggacgacatccccaaagtcgtccatgtctctgtccaca
gaaaccaccagtactgtcggcatgttcagtttctggcaaaaaggctcacagtcagatgca
gaagagaaaggaagagagattgacgagataatgcaagagatcaatgtggacagagagatg
gaaaacgaaaggcgagaatctgaaaaggagagtgaggatctgaaagtggttgaagccgcg
atagagagaagtccgagttctggtcagggatataacctcccaggaagccatgccaaaagt
cacggatgcgagtgggggaataaaaaggtctggagaattgtgttgaggcgggtggatcgt
ggaaagatagtgagcttaacggcctttgaagaattgggaatcttgtgtgttttaagagat
gaaggactgttggagattttctctttgaccactttgcaatgcgtggattacctggagctt
gaggggcccaactcacgtcatttgcagaaggacccttctaacagcaatactgccatcgtc
aagctagggcaagtctggtcctggagtggtatacatatggctagaaacgatacatcacat
atactcgttgcacatggtcttccctggccttgtgaaacacctagccctaacggagaagtg
actcgagtaataatcttgctattcaatcaggatcaacagcctttgctcgatcctattgca
aagctcgagcttcctggagaaggtgacgttgggttatgtcaggacggtgatactaattac
ttaatccacgcaactcccacatccttaacatcatatcctatcatctactctcaacacaaa
gcctccccttcgagctctctacaacttcatcctgggcattcatcagcagcttatccctct
cgctcccatacaccgaatcttgagtcgtcagacgcttcctcgtctctcttaagaaaatcg
gtctcttcatcccgccttctcgatccccatcaatctcatccacatgaaaaagaacacagc
tttgcgagattccttgctcggcgaacggattggtctaagaaaaaagatgaagaacatggc
gatcagccgatcatacatcctgctttgggagagggtaaagaagttgagagggacggatac
ggacattggacaagaattaagttgcatgagaatggagaaggagttgggtgggctgatgat
ggaatcgatgagtttcaatgtgacgggaaatcattgtggattaaggggacaatatcatgg
acaaaaagggtatccgctcgagaggtggtattcagcaaaggctggaaaaaaatcgtcatt
ctgcgtgcagatggaaagcttgctgtatatgcgccgcaaggtaatgaggtgcccaaggaa
ggtagtcgtctgaagtttgaacagaagtctatcgatgatgatgtgaatgctatttgcttg
acagagtcgggaaagctcttgttgagtaatgtcagcgccgtgcaaaagggagacatagat
agccctgtaatcagctttaaaaagtatctgacgcttgaggaaccaccagaagaagaaaat
ggttctttcagtcatgtcgtgccttatggagtggagaacgtccttgttgctgatcgccaa
ggaaatgtctatcttcgaaagctagatagggtcatacatcaagataatatagaccctact
acggatgataagccaagtgttgaccgactcgacgcagctgttacgtgtatgaagattgta
cgaggtccagaggaaaatgacaaaaagtatcttgttgcgggcgatgaagatggagtaatt
aggatatggactgtagaagagttccaattttgcggctcctggacactctttgcctggcca
gtaagcgattttgtgcttttggatatgcctcaagctgggcctctgcatggcacattgctt
tgtacctcccaagcgggcaccgtcggtattatatccctgtccgaaatggaacagcttttc
ctaattccggctgcaagatctcctctccgccacatctatttggcaaatactgacatcctc
ctggcgtatgcgaatgggaaagcaagggtatggaataccgaaacacaggagttcaggcgc
tccacagggctggacgctgcggaagatatgttacaggctgggaactggacgagagttgac
ttaacaaaacgacatacacaaacacctttgaccgcttgtgtggctcagccatatgcagca
agccaacttggacgtcttctcaatctcgatcttcgcgaactcggtcgctggttgcactct
tccaagaacaacccgcatcatagtcctcttccagctcttcggagccttctctctattctt
tttaccttcggagttagcgacaaagtcgatgagacgtgtatcaggaacctaggtgtgcac
aagcctgagaaacccattatggtaggatatggaagtgcagatacccatgaaattgtatat
gcgcaaggagttgactcatggcgaatatcggagcgaatcacaggggtgagacagttggca
atcataactgtcttaagaccgttcttagactccccagatttagaacaatgggccgctgaa
gtgatagcgttttacactgcgtcattacctccaaacatcatcgaaccggacctagagttc
ttcgcgtcttactacatggatccctcctacgacgttcatcaggcggccagattattattt
gcggccagagtagggagactgtcaggctctgagatagacacagttgctcgaaccagagaa
catgaactgcccatccttcagcccgaggaacgcaagttttgtggttcggccgccaatgct
ttgacggtattaggtggtatcgccttgcaaaaatatcagtgcatgggtcctgctgcgctc
aaagctctcgctgagtcagtggctctttaccttcatgaaccgaactgcgactacatctct
ctagcggtagagctctgctcgaaaggttttacaatttggcaaagctatgtagacccttcg
gaccttctgcgccgcctcttccatctggcaaccaacaaagagccgccgtccatgtcctcc
cattcttctactagcatagccgctcaagcgcgtttagctattctgctggtcgcttcctct
aatccccctcttttcatgtctacactttcaatggacatattggacgccaagagcgccgag
agtagaagtagtatcatgaagctatgtgtatttatggccagaaaaaagcccgcagtgttg
gagaatggattacctaggatagcagaggcggtcgttaagagtctcgacccgaatgttggt
aagatgagggatgacgtctggcaagcagctactgtcatcttaaatgagctcgttttagca
ttttctacgattgacttccacagtcggactcagcgcctggctgtggggacacacgaagga
gcagtcataatgtatgatctcaagactgcatctcgactatacgtccttgaaccgcacaag
gccccagcctcggcggtttgcttctcgcctgatggacgtcgactggtcacagtgtcaata
gaggaagggtctgtcaccgtttggaaggttgggagtagtctaagcggatttttcaacgtc
ggtggtccacctaggcaaggtggtgaaaagggggagccgttcaagcggatagaatttaag
agggccgatgaccgtcctcttgattcaacttcggcattaagtgacgtacagataacatgg
ttgggtgctagacaggccagagtcacgataaaagagacagcattgacatttgagacatga

DBGET integrated database retrieval system