KEGG   Cryptococcus neoformans var. neoformans JEC21: CNE03860Help
Entry
CNE03860          CDS       T00243                                 

Definition
(RefSeq) mRNA methyltransferase, putative
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cne03019]
    CNE03860
Enzymes [BR:cne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     CNE03860
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     CNE03860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 3257559
NCBI-ProteinID: XP_571196
UniProt: Q5KGE9
Position
5:complement(join(1103584..1103678,1103734..1103790,1103849..1104060,1104115..1104353,1104413..1104443,1104498..1104788,1104836..1104891,1104945..1105037,1105091..1105167,1105220..1105289))
Genome map
AA seq 406 aa AA seqDB search
MESPSRPPTPPLPTLAPSSSKGQKRDESILELNSLLDRETAKSKLRRLAISTSCLPPLFN
PLCPSTTLAACKQVRHECTKAHFDPIQRPWTDSTLGFCSYLNLCYGDPMFTKNPSLGDGS
GPRGGTKDCRYQHFQVTPSTIRCTQPLPEGYPSVMPGYLKKRVLGDEDVERQDKEADVAQ
WVNCDLRRFDYSLLGQFQVIVADPAWDIHMTLPYGTITDDEMRNMPIRSLQPDWGILCLW
VTGRAMELGRVVFAHWGYKRVDELVWVKTNQLQRLIRTGRTGHWLNHTCEHLLVGLKLPQ
NFPRDAPIPWDTEPALRHLRKCVDTDVVVAEVRETSRKPEEVYGVIERLAPKGRKLELFG
RKHNTRPGWVTLGNQLGDSQIAEPDLYDRLVKAYPKQKFTFVPSKQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggagtctcctagccgcccacctactcctcctctccccactcttgccccttcttcaagc
aagggacaaaaacgggacgaatccatcctcgagctgaactcgcttctcgacagagagacg
gccaaaagcaaattgcgacgcttggctatatctacatcgtgtctaccgcccttgttcaat
ccgctatgcccatcaacaacgctcgcggcatgtaaacaagtgcgacacgaatgtaccaag
gcccattttgatcccatacagagaccatggacagactctacccttggtttctgctcatac
ctaaacttatgctacggcgacccgatgttcactaagaacccttcattgggggatggttca
ggcccgcgcggagggactaaagattgcagataccagcattttcaagttaccccttccact
attcgttgtactcagcctttacctgaagggtatccctccgtcatgcctggctatttgaag
aagagggtactgggggatgaagatgtagaaaggcaagacaaggaagcagatgtggcgcaa
tgggtcaactgtgatctgaggaggttcgactactctcttctgggacaattccaagtgatt
gtcgccgatcctgcgtgggatatccacatgactcttccgtacggcactataacggatgac
gagatgcggaatatgcctatccgttctcttcagcctgactggggtattctttgtctatgg
gttactggacgagcgatggagttaggcagagttgtatttgcgcactggggctataaacga
gtggatgaactggtttgggtcaagacaaatcaactgcaaaggctgattaggacaggaaga
actgggcattggttaaatcacacgtgcgagcatcttcttgtaggcctcaaactccctcag
aactttccacgtgatgcacctattccatgggacacagaacccgctcttcgacatctgagg
aaatgtgtggataccgatgtggtggttgcggaagtaagggaaacaagcaggaagccggag
gaagtctatggggttattgagcgactggcgccgaaaggaaggaagctagaattgtttgga
aggaagcacaatactaggcccggatgggtcacacttggcaatcagctcggagattctcaa
atagcagaaccagacttgtacgaccgtcttgtcaaggcatatcccaaacagaaattcact
tttgtgccttcaaagcaataa

DBGET integrated database retrieval system