KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF00655Help
Entry
CNF00655          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cne01009]
    CNF00655
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     CNF00655
Protein phosphatases and associated proteins [BR:cne01009]
 HAD phosphatases
  Other HAD phosphatases
   CNF00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 36392890
NCBI-ProteinID: XP_024514484
Position
6:complement(join(220887..220907,220961..221094,221154..221391,221439..221504,221561..221784,221834..221855,221914..221937))
Genome map
AA seq 242 aa AA seqDB search
MKLDRDSEKIVAEVTDTILGRYGHSLTWEIKAGAMGKPLPTASEWILSHFPDIREQLSVE
EFIEEGARMKAKLFKEVEPMRGATALVKGLYEAGIPIALATGSSMQNFIYKTTHLPHIFG
HFPPSCIITADSPGIKGKPNPDIFLAAARSLGRDVGISDECSELQKEERRKGLVFEDSVP
GVLAGVAAGMNVIWVPHAEVKALNPEETYGAREVLAHLEEWDPTKWNLPLLPGFANDLPL
KI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgatagagattctgagaaaattgtggcagaagtgacagatactatccttggc
cgatatggtcattctctgacttgggagattaaggccggagctatgggcaagcctctaccg
accgcctcggaatggattttatcccacttcccagacatacgggagcaactatcggtagag
gaattcattgaagaaggtgcaaggatgaaagccaagctgtttaaagaagttgaaccgatg
agaggtgcaaccgctttggtcaaaggcttgtacgaggcagggataccaatcgccctggcc
acaggctctagcatgcaaaacttcatctacaaaacgactcatctcccccatatctttggt
catttcccgccctcttgcatcattactgccgattctccaggaatcaaaggaaaaccgaac
cctgatattttcctcgctgctgctcgatctttaggcagggatgttggtatttccgatgaa
tgctcagagctccagaaggaggaaaggaggaagggcctggtatttgaagactctgtaccg
ggagtacttgctggagttgctgcgggcatgaatgtcatatgggtgccgcacgcagaagtc
aaggctcttaatcccgaagaaacatacggtgcccgagaggttcttgcccatctggaagaa
tgggaccctacaaagtggaatctccctttgctgcctggattcgctaatgatttgccccta
aaaatataa

DBGET integrated database retrieval system