KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF03190Help
Entry
CNF03190          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNF03190
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CNF03190
Protein kinases [BR:cne01001]
 Serine/threonine kinases: Other
  TTK family
   CNF03190
Chromosome and associated proteins [BR:cne03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CNF03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 3258150
NCBI-ProteinID: XP_571649
UniProt: Q5KF39
Position
6:complement(join(949312..949650,949703..949768,949809..949967,950009..950104,950155..950421,950781..951104,951503..952033))
Genome map
AA seq 593 aa AA seqDB search
MSSPENDRVLDNLWTTEDESFEVQMPDFHFDWGLEKGKTADQGIKAPTASLRSLSINEIT
PPLPSGSSSTSTPPHSTISARSSISSAQILPKRDISNASSSPHIPTPPGSIANPGHRSLS
AQNFANSGGSSGGESSGERGKTYGGRKFQRVVSAPISPENGTDTEGVEFQVSGNVCSTDV
TDPPPQGPPDVYCSSDQAIVSPTATAGCESRLTNISHPDDRPVKPARKPVNQSVHEINES
IHEPMALATQSQAEHGVSRTSAAVPSEGEDRLFRPFGKLEETLRPVNGVPYERLQRLGKG
GSSTVYSVLYSGPKKRIIYALKVVQLDRADSETYQSYTNEIELLKRLRGHDRVIQLIDHQ
ITFNQHNRPHRLLMVMECGEIDFAALLDEQRGKAINMNFVGLYWEQMLEAVQAVHRENVV
HTDLKPANFVLVKGRLKIIDFGIAKAIANDTVNIQRDQQIGTVNYMSPEAIQRMNNQKVL
KLSYPSDVWSLGCILYQMIYGSPPFQHVSGGPLAKMGVIADPNHVVTYPEVAVPKAAVGF
SLDGHPTDPASLSVPVSPSAIDSMKRCLAYRKEHRLTIPELLQHEFLKPRIRG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaccggagaacgatcgcgtgctggataatctgtggacaaccgaggacgagtcg
ttcgaagtgcagatgccggacttccattttgattggggattggagaaaggaaaaaccgca
gatcaaggaattaaggcccctacggcgtccttacgctctctatccatcaacgaaatcacc
ccaccccttcctagtggctcttcatccacctctacccctcctcattccaccatatcggca
agatcttcaatatcttctgcccagatattacccaaaagggatatctctaatgcgtcgtca
tcacctcatatacccactcctcctggaagcatcgccaatcccggccatcgatcattatct
gctcaaaacttcgccaattctggaggaagttccggcggggagtctagcggtgaacggggc
aaaacttatggtggccgcaagttccagcgcgtagtgtctgccccaatatcgcccgaaaat
gggacggatacggaaggagtagaatttcaagtttcaggaaatgtttgctcaactgatgta
acagatcccccaccccaagggcccccggacgtttattgttcatcggatcaagcaatcgtt
tccccaactgcgacagccggatgcgaaagtcggttgacgaacatatcacatccagacgat
cgaccagtaaaaccagcgcgcaaaccggtaaaccaaagcgtacatgaaataaatgaatca
attcacgagccgatggctttagctactcaatcgcaagcggaacatggggtatcacgtaca
tcggcggccgtaccttcagaaggagaggacagactatttcggcctttcggtaaactggaa
gaaactctgcgacctgtgaacggagtcccatacgaaagattacaacgcttgggaaagggc
ggctcgtcgactgtttattctgtcctttattcgggtcctaaaaaaagaatcatctatgct
cttaaggtagtacaactcgaccgtgcggactccgaaacatatcaaagctacacaaacgaa
atcgagcttttgaagcgtctccgtggacacgatcgtgttattcagctcatcgatcatcaa
ataaccttcaaccaacataatcgccctcatcgtttgctgatggtcatggaatgcggcgag
attgattttgcagcgttgctagatgagcaacgggggaaagcaattaatatgaactttgtc
ggtttatattgggagcaaatgcttgaagctgtccaagccgtccaccgcgagaatgttgtt
catacagatttgaaaccggcgaactttgttctcgtgaaggggcggttgaaaatcattgat
tttggcattgcaaaagcaatagcaaatgacactgtcaatattcagcgcgatcagcaaatt
ggcaccgtaaactacatgtcacctgaggctattcaaagaatgaacaatcagaaggtattg
aagttatcctatcccagcgatgtttggtcacttggttgtatcctttaccaaatgatttat
ggtagccccccctttcaacatgttagtggaggaccactggcgaaaatgggtgtgatcgca
gatcccaaccacgtcgtcacatatccagaagtggctgtacccaaggcagcagttggattc
agtcttgatggtcatcctacagaccccgcaagtctatcagtccctgtcagcccgtccgcc
attgattcaatgaagcgatgcctagcatatcgcaaagagcatcgactgacaatacctgaa
ttattgcaacatgagtttctaaagccaagaataagaggttag

DBGET integrated database retrieval system