KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG03280Help
Entry
CNG03280          CDS       T00243                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, putative
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00030  Pentose phosphate pathway
cne00480  Glutathione metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cne_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CNG03280
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNG03280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cne04147]
    CNG03280
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CNG03280
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CNG03280
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CNG03280
  Exosomal proteins of colorectal cancer cells
   CNG03280
  Exosomal proteins of bladder cancer cells
   CNG03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 3258904
NCBI-ProteinID: XP_572045
UniProt: Q5KDP3
Position
7:join(926779..926980,927029..927589,927627..927703,927744..927945,927984..928325,928384..928483,928553..928583)
Genome map
AA seq 504 aa AA seqDB search
MAAPSNNKSGTIPSMEASGEALTDETVVIVLGASGDLAKKKTFPALFALFTQGLLPKDVH
IVGYARTKMDKDEFHRREIQYIKGDQEKIKQFQELSSYVSGPYDEDAGYKELLKHVEELE
RDRKTRNRIFYMALPPSVFTTVAKGLKKNCYSSQGTNRIIIEKPFGKDLESCRQMMSELK
SQWAENETYRIDHYLGKEMVKNLLVLRFGNVFLDASFNKNFVSNVQITFKEPFGTEGRGG
YFDEFGIIRDVCQNHLMQALSILAMERPVSFSAEDIRDEKVKVLRCIPAIDRKDVLFGQY
VAAGDKPGYLEDDTVPKDSICPTFAAMTLWINNPRWEGVPFIMKAGKALNEAKVEIRVQY
KDATQGIFTDISRDELVMRIQPDEAVYLKMNNKLPGFHTRAVPVELDLTYKKRFTDANIP
QAYEALILDALKGDHSNFVRDDELDVAWKIFTPILHWIDSKDAPKPEPYPYGSRGPKQID
EFAAKYGFKRSPQTYSWPKTSASL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccttctaacaacaaatcaggcaccattccttccatggaggcatccggcgaa
gctcttacagacgagactgtcgttatcgtgctcggtgctagtggtgaccttgccaaaaag
aagaccttccctgccctttttgcccttttcactcagggccttttgcctaaggatgttcat
attgttggatatgcgagaaccaagatggataaggatgagttccacaggcgcgaaattcaa
tacatcaagggcgatcaggaaaagatcaagcaattccaagaactttcttcttacgtatcg
ggcccttacgacgaggatgctggttataaagagcttctcaagcatgtggaggagcttgaa
cgcgataggaaaacccgtaaccgcattttctacatggctcttcccccttcagtttttact
accgttgccaagggtctcaagaagaactgttactcttctcaaggtaccaatcgtatcatc
attgaaaagccattcggcaaggatctcgagtcatgccgccagatgatgagtgaactcaag
tcccagtgggcggaaaacgaaacctaccgtatcgatcactacctcggcaaagagatggtc
aagaacctacttgttctccgctttggcaatgtcttcctcgatgcttctttcaacaaaaat
tttgtcagcaacgttcagatcaccttcaaagagcctttcggcaccgagggtcgtggagga
tactttgacgaatttggaattattcgcgatgtttgccaaaaccatctcatgcaagctttg
tcgatacttgctatggaacgacctgtttctttttctgctgaggatatcagggatgagaag
gtcaaggttctccgctgcatccctgctattgaccgcaaggacgttcttttcggtcaatat
gtcgccgctggggacaagccaggctaccttgaagatgataccgtacccaaagactctatc
tgtcccacatttgccgccatgactttgtggattaacaacccgcgatgggaaggtgttcct
ttcatcatgaaggcaggaaaagctttgaacgaggccaaagtcgaaattcgtgtgcagtac
aaagatgctacgcagggtattttcaccgatatctctcgggacgagcttgtgatgcgcatt
caacccgatgaagctgtatacctcaaaatgaacaacaagcttcctgggttccacacgcgt
gctgttcctgttgaacttgacctcacctataagaagcgattcacggacgccaacattcct
caggcgtacgaagctctcattctcgatgctctcaagggcgatcactcgaactttgttcgt
gatgacgagctggatgtcgcttggaagatcttcacccccattcttcattggatcgacagt
aaagatgcgcctaagccggagccgtacccctatggttcccgaggacccaaacaaatcgat
gaattcgctgccaagtatggattcaagcgcagcccgcagacttattcctggcctaagaca
tctgcaagtctttga

DBGET integrated database retrieval system