KEGG   Cryptococcus neoformans var. neoformans JEC21: CNH03260
Entry
CNH03260          CDS       T00243                                 
Name
(RefSeq) conserved hypothetical protein
  KO
K12864  beta-catenin-like protein 1
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CNH03260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cne03041]
    CNH03260
Spliceosome [BR:cne03041]
 Complex B
  Other components
   Prp19 complex
    CNH03260
 Complex C
   Prp19-CDC5 complex
    CNH03260
SSDB
Motif
Pfam: CTNNBL Arm Mo25 DUF3384 Wheel DUF5748
Other DBs
NCBI-GeneID: 3259134
NCBI-ProteinID: XP_572496
UniProt: Q5KD46
Position
8:complement(join(182474..182601,182672..182744,182812..182946,183057..183456,183543..183691,183769..184086,184160..184439,184523..184671,184778..184857,184948..185091,185352..185433))
AA seq 645 aa
MDIDKMFKLPALPSGGNKRKMGDLPNPETLKKYKPSEPQAASEMMPPPPPGGLNGKGKGR
AVTVEDDDVEAEYSRDVGEDVYDGEDDEEGRFFGGGLNREQEQILDIFDAAGEGEQGPAL
DLPALRRQIGKFQRIVLKNAEQRGKYSDDPSKFIDSESDLDTSLKAFLPLTQNPPLFYPE
LVKSGIIPIFANLLSHENTDIAMDVVEVIQELTDEDVGGEVDDLDHEEETGSETRMAMGQ
LIDELLNNSLLDLLVSNLSRLDESEDTDSQGVFHILGVFENLLSFMPPLADQIVEETALL
QWLLQRIKKKEYDSNKQYASEIIAILLQDSRANVLKLGQLDGMDVMLQVLSQYLKTDPGD
SEEVEFMENVFDSVCSSLAQPEMKKAFFDAEGVELMVLMMKEKRLAKTRAIKVLDYALQT
ESGSPACERFVQALGLKTFFSAFMSSASSKAGGKKSKSKLGAAAATSAIEDEEHMLGILA
SLFTNLASDSPERIRVIAKFVEGGYEKVERLLEVREAAEGRLGSVIKEIEYEREVMQANE
EEITDVEETEWYLRKMDAGLASLQNADYVLAWVCMEDDGAMTHARLLLSRKNMNFKTIAA
VLTEFKNNVGDNDEPNEEDGQREADDAVNTQKMILEHLIAFLEGL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggatatcgataaaatgtttaaactcccggcgcttccttcgggggggaacaagcgcaag
atgggcgatctgcctaatcctgaaacgttaaaaaaatacaagccttccgaaccgcaagct
gcttctgagatgatgccccctcctccacctggcggactgaatgggaaaggaaaagggaga
gcggtgacggtagaggatgatgatgtcgaggccgaatactcgcgagatgtaggagaagac
gtctatgatggtgaagacgacgaggaaggaaggttctttgggggtgggcttaatagggag
caggagcaaatccttgatatatttgatgcagccggcgaaggcgaacaaggtcccgctctt
gatctaccagcgctcaggaggcagataggcaagtttcagcggattgtcttgaaaaatgcc
gagcagcgtggaaaatactctgatgatccttccaaattcatcgactctgaatccgacctc
gatacctctctcaaagctttcctccctctcactcagaacccgccgctcttctaccccgaa
ctcgtgaaatccggtatcatccccattttcgccaacttgctttctcacgaaaataccgat
atagcgatggacgttgtggaggtgatacaagagttgacggatgaagatgttggaggggaa
gtggatgatttggaccatgaggaagagacgggaagtgagacgaggatggcaatgggtcaa
ttaatcgacgagcttctgaacaactctcttctcgacttgctcgtttctaacctctctcgt
cttgacgaatccgaagataccgactctcaaggtgttttccacatcctcggcgtcttcgaa
aaccttttatcatttatgcctcccctggccgatcagattgttgaagaaacggctctactc
cagtggttattacagcgtatcaagaagaaggagtatgatagcaataagcaatacgcgagt
gagatcatagcgatcctgttgcaggatagtcgggcgaatgtgctcaagctgggccagttg
gatggaatggacgtgatgttgcaggttttgtctcaatacctcaagacagatcctggagac
agcgaggaagtagagtttatggagaacgtgtttgacagcgtctgctcttctttggcccag
cctgaaatgaaaaaagcattcttcgatgctgaaggtgtggagctcatggtccttatgatg
aaggaaaagcgcctcgccaaaacacgcgcaatcaaagtcctcgattatgccctccaaacg
gaatccggctctcccgcatgtgaacgcttcgtccaagctctcggtctcaaaacctttttc
tccgccttcatgtcctccgcctcctcaaaggcaggagggaagaagagcaaatccaaactt
ggcgctgctgcggccacttcggcaattgaggatgaagaacacatgctcggtattttggcg
agcctctttacgaatcttgcaagtgacagtccggagagaattcgggtgattgccaaattt
gtggaaggaggttatgaaaaggtggagaggctgttggaggtgagggaagctgctgaaggg
aggttggggtcggttatcaaggagattgaatacgagcgggaagtgatgcaagcgaacgaa
gaagaaatcaccgacgttgaagaaacagagtggtatctccgaaagatggatgcggggctt
gcgtcgttgcaaaatgcagactacgtattggcatgggtctgtatggaggatgatggggcc
atgacacatgctcgattgttgttatcaagaaagaacatgaacttcaagacgattgcagct
gtcctgaccgagttcaagaacaatgtcggcgataatgatgagccaaacgaggaagatgga
caaagagaagcggatgatgcggtgaacactcaaaagatgatattggagcatttgattgcg
tttttggaaggtctttga

DBGET integrated database retrieval system