KEGG   Cryptococcus neoformans var. neoformans JEC21: CNI01740Help
Entry
CNI01740          CDS       T00243                                 

Definition
(RefSeq) trans-hexaprenyltranstransferase, putative
  KO
K05355  hexaprenyl-diphosphate synthase [EC:2.5.1.82 2.5.1.83]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00900  Terpenoid backbone biosynthesis
cne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CNI01740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cne01006]
    CNI01740
Enzymes [BR:cne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.82  hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     CNI01740
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     CNI01740
Prenyltransferases [BR:cne01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CNI01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 3259709
NCBI-ProteinID: XP_572668
UniProt: Q5KBQ7
Position
9:join(483709..484821,484872..485210)
Genome map
AA seq 483 aa AA seqDB search
MLRRPALPTRAFPKHRISSTFSFSTSQRRSSVSSSPAKQPESTWAAATTEAHRVLTPPPA
TSASTVTSLDDPLSAINSEIGNLKSSLWRMLGSSNSALDTVAKYYFQAEGKHLRPLLVLL
MSQATNGLGGKGWDGAKREAIRRKVDDSLTAEGGVLNDWNPEVSGPEPSSGLGSMVFASP
FRIPEAGAPAIPEPEPLPSQFDELLGEGNGQPVILPTQRRLASITEMIHVASLLHDDVID
SSSLRRGTPSAPSTFGNKLSILSGDFLLGRASVALARLGSREVVELLATVIANLVEGEMM
QLRATSEPEKAPTAKGFEDYMRKTYLKTASLMAKSARAAVILGGCGSVSEEGAWVKDVAY
GYGRNLGIAFQLIDDALDFLPPDSSLGKPSLGADLRLGLATAPALFAWETHPSMGPLILR
KFTEPGDVEAARDLVARSDGLQRTIELAREFAGEARRLVEMLPESGARDALVQLTVKVVE
RVK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgcccagcccttccaaccagggcattccctaagcaccgcatctcctcaacc
ttctccttttccacctcacagcgacgctcatcggtctcctcttctccagctaaacagcca
gaatctacctgggcagctgccactacagaagctcatcgagtccttacccctccaccggct
acttcagcttcaacagttacctcactcgatgatcctctatccgccattaactccgagatt
ggtaacctcaaatccagtctctggcgtatgctcggctcttccaattctgcgctcgacacc
gtcgcaaagtactacttccaagctgaagggaagcatctcaggccgttgttggtgttactc
atgagtcaggctaccaacggattaggtggtaagggatgggatggggcaaaacgagaggcg
attaggagaaaagtggatgacagtcttacagctgaaggaggtgtgctgaatgactggaac
ccagaagtctctgggccggagccttcatcaggtttgggaagtatggtgttcgcctcaccg
ttcagaatacctgaggctggagcgcccgctatccccgagcctgaacccctcccttcccag
ttcgacgaattattaggagaagggaacggtcagcctgtaatcttgcctactcaaaggcgg
ttggccagcattacagaaatgatccatgtcgcttcattgctgcatgacgacgtcattgac
tcttcttctctgcgacgtggtaccccttcggctccatcaaccttcggcaacaagctctcc
attctctctggtgatttcctgttgggtcgcgcttctgtcgcccttgcccgtcttggctct
cgagaagttgttgaattgcttgctaccgtcatcgccaaccttgtagaaggtgaaatgatg
cagttgagggcgacaagcgaacccgaaaaggctcctacggccaaaggttttgaggattac
atgagaaagacatacttgaagaccgcgagtttgatggccaaaagcgcaagggccgctgtc
atccttggtggttgcggatctgtgagcgaagagggagcgtgggtaaaggatgttgcatat
ggatatggcaggaatctgggtatcgctttccagctgatcgacgatgcccttgacttcctc
cctcccgattcttctctcggcaagccttctcttggtgccgatctccgtctaggtctcgcc
acggcgcccgcccttttcgcctgggagactcacccttcaatgggccccctcatcctccgt
aaattcactgaaccaggagatgttgaggctgcccgagatcttgtggccaggagtgatgga
ttgcagagaacaattgagttggctagggagtttgcaggtgaggcaagaaggttagtggag
atgttgccggagagcggagcgagggatgcgttggtgcagctaacggtcaaggtcgtcgag
cgagttaagtag

DBGET integrated database retrieval system